Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN785165

Inhibin Binding Protein (INHBP) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI747649, mKIAA0364, 5330413N23, 5530402E03, InhBP/p120, Inhbp, CHTE, IGCD1, IGDC1, INHBP, PGSF2, p120
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN785165
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-IGSF1 antibody: synthetic peptide directed towards the N terminal of human IGSF1
Sequence WLLARPSAVVQMGQNVSLRCRGPVDGVGLALYKKGEDKPL QFLDATSIDD
Predicted Reactivity Human :100% Rat :92%,   Mouse :92%,  
Characteristics This is a rabbit polyclonal antibody against IGSF1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name IGSF1
Background Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior. Members of the immunoglobulin (Ig) superfamily (see MIM 147100), which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.
Molecular Weight 149kDa
Gene ID 3547
NCBI Accession NP_001546, NM_001555
UniProt Q8N6C5
Research Area Signaling, Hormones
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-IGSF1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Inhibin Binding Protein (INHBP)", type "Antibodies"
Hosts (32), (3)
Reactivities (31), (24), (22), (17), (17), (2)
Applications (21), (15), (10), (7), (6), (5)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (3), (2), (2), (2), (2)
Beacon