You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) Caspase 7 antibody for Immunohistochemistry (Frozen Sections)

Recommended Caspase 7 Antibody (supplied by: Log in to see )

Antigen
Caspase 7, Apoptosis-Related Cysteine Peptidase (CASP7) Antibodies
  • AI314680
  • CASP-7
  • CASP7
  • Caspase-7
  • caspase-7
  • caspase7
  • cmh-1
  • CMH-1
  • ICE-IAP3
  • ice-lap3
  • ICE-LAP3
  • LICE2
  • mCASP-7
  • Mch3
  • mch3
  • MCH3
  • MCH3/SCA-2
  • SCA-2
  • xCaspase-7
Epitope
AA 207-303
32
29
12
7
6
6
6
6
6
5
5
3
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Mouse (Murine)
286
108
85
8
7
4
4
3
3
2
1
1
Host
Rabbit
202
91
4
Clonality
Polyclonal
Conjugate
This Caspase 7 antibody is un-conjugated
14
11
9
4
3
3
2
2
2
2
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
249
103
84
72
31
20
13
12
8
7
5
4
3
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN1862283
$ 356.40
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.00088411616 ABIN1077917 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG AA 24-198 Log in to see Polyclonal
0.00088411616 ABIN4288136 IHC IHC (fro) IHC (p) IP WB Rabbit Log in to see Polyclonal
0.00088411616 ABIN4288137 IHC IHC (fro) IHC (p) IP WB Rabbit Log in to see Polyclonal

Similar anti-Caspase 7 Antibodies

Application / Reactivity Mouse (Murine)
ELISA 32 Antibodies
Enzyme Immunoassay (EIA) 3 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 5 Antibodies
Immunofluorescence (IF) 3 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies
Immunohistochemistry (IHC) 43 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 4 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 43 Antibodies
Immunoprecipitation (IP) 15 Antibodies
Western Blotting (WB) 91 Antibodies

General

Antigen Caspase 7, Apoptosis-Related Cysteine Peptidase (CASP7) Antibodies
Epitope AA 207-303
(32), (29), (12), (7), (6), (6), (6), (6), (6), (5), (5), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Mouse (Murine)
(286), (108), (85), (8), (7), (4), (4), (3), (3), (2), (1), (1)
Host Rabbit
(202), (91), (4)
Clonality
Polyclonal
Conjugate This Caspase 7 antibody is un-conjugated
(14), (11), (9), (4), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
(249), (103), (84), (72), (31), (20), (13), (12), (8), (7), (5), (4), (3), (1)
Supplier Log in to see

Product Details anti-Caspase 7 Antibody

Target Details Caspase 7 Application Details Handling Images
Sequence MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-ANPR NKIPVEADFL FAYSTVPGYY SWRNPGKGSW FVQALCSILN EHGKDLEIMQ ILTRVNDRVA RHFESQSDDP RFNEKKQIPC MVSMLTKELY FSR
Specificity It has been selected for its ability to recognize CASP7 in immunohistochemical staining and Western blotting.
Purification Affinity Chromatography
Immunogen Recombinant CASP7 expressed in E.coli.
The antibody is a rabbit polyclonal antibody raised against CASP7.
Isotype IgG

Target Details Caspase 7

Product Details anti-Caspase 7 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Caspase 7 (CASP7 Antibody Abstract)
Pathways Apoptosis, Caspase Cascade in Apoptosis

Application Details

Product Details anti-Caspase 7 Antibody Target Details Caspase 7 Handling Images back to top
Application Notes Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Optimal working dilutions must be determined by end user.
Comment

Content: The quality control contains recombinant CASP7 (Ala207~Arg303) disposed in loading buffer.
Usage: 10 µL per well when 3,3'-Diaminobenzidine(DAB) as the substrate. 5 µL per well when used in enhanced chemilumescent (ECL).
Note: The quality control is specifically manufactured as the positive control.Not used for other purposes.
Loading Buffer: 100 mM Tris(pH8.8), 2% SDS, 200 mM NaCl, 50% glycerol,BPB 0.01%, NaN3 0.02%.

Restrictions For Research Use only

Handling

Product Details anti-Caspase 7 Antibody Target Details Caspase 7 Application Details Images back to top
Format Liquid
Concentration 200 µg/mL
Buffer Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Preservative Sodium azide
Precaution of Use WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.
Handling Advice Avoid repeated freeze/thaw cycles
Storage 4 °C
Storage Comment Store at 2-8 °C for one month. Aliquot and store at -80 °C for 12 months.
Expiry Date 12 months

Images

Product Details anti-Caspase 7 Antibody Target Details Caspase 7 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Caspase 7 antibody (Caspase 7, Apoptosis-Related Cysteine Peptidase) (AA 207-303) (ABIN1862283) anti-Caspase 7, Apoptosis-Related Cysteine Peptidase (CASP7) (AA 207-303) antibody