anti-Human NAIP antibody for Immunohistochemistry

Recommended NAIP Antibody (supplied by: Log in to see )

Antigen
NLR Family, Apoptosis Inhibitory Protein (NAIP) Antibodies
  • BIRC1
  • NLRB1
  • psiNAIP
  • Birc1
  • Birc1a
  • Birc1b
  • Naip
  • Naip2
  • NLR family, apoptosis inhibitory protein
  • NLR family, apoptosis inhibitory protein 6
  • NAIP
  • Naip6
Reactivity
Human
51
5
1
Host
Rabbit
40
13
1
Clonality
Polyclonal
Conjugate
This NAIP antibody is un-conjugated
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
27
24
13
9
8
7
4
2
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4337757
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.906923 ABIN2435040 IHC ELISA Rabbit IgG Log in to see Polyclonal
1 ABIN4337756 ELISA ICC IF IHC IHC (p) WB Rabbit C-Term Log in to see Polyclonal
1 ABIN1869394 ICC IHC IP WB Rabbit IgG AA 923-1148 Log in to see Polyclonal
1 ABIN2210648 IC IHC ELISA WB Rabbit C-Term Log in to see Polyclonal
1 ABIN2768479 IHC (p) IHC WB Rabbit C-Term Log in to see Polyclonal

General

Antigen NLR Family, Apoptosis Inhibitory Protein (NAIP) Antibodies
Reactivity Human
(51), (5), (1)
Host Rabbit
(40), (13), (1)
Clonality
Polyclonal
Conjugate This NAIP antibody is un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(27), (24), (13), (9), (8), (7), (4), (2), (2), (2), (1)
Supplier Log in to see

Product Details anti-NAIP Antibody

Target Details NAIP Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KSGIQCFCCSLILFGAGLTRLPIEDHKRFHPDCGFLLNKDVGNIAKYDIRVKNLKSRLRGGKMRYQEEEARLASFRNWPFYVQGISPCVLSEAGFVFTGKQD
Isotype IgG

Target Details NAIP

Product Details anti-NAIP Antibody Application Details Handling Images back to top
Antigen
Alternative Name NAIP (NAIP Antibody Abstract)
Background Gene Symbol: NAIP
Gene ID 4671
Pathways Apoptosis

Application Details

Product Details anti-NAIP Antibody Target Details NAIP Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-NAIP Antibody Target Details NAIP Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-NAIP Antibody Target Details NAIP Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-NLR Family, Apoptosis Inhibitory Protein (NAIP) antibody (ABIN4337757) Immunohistochemistry: NAIP Antibody [NBP1-88596] - Staining of human placenta shows m...