You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human Complement Factor B antibody for Immunohistochemistry

Recommended Complement Factor B Antibody (supplied by: Log in to see )

Antigen
Complement Factor B (CFB) Antibodies
  • bf
  • Bf-1
  • Brre-Bf
  • zgc:114032
  • Bf
  • Sp152
  • bfb-A
  • Bf B
  • LOC397725
  • fc04c04
  • wu:fc04c04
  • bf/c2
  • CFB
  • AHUS4
  • BF
  • BFD
  • CFAB
  • FB
  • FBI12
  • GBG
  • H2-Bf
  • PBF2
  • AI195813
  • AI255840
  • B
  • C2
  • Fb
  • Da1-24
  • complement factor B
  • zgc:158446
  • ATP synthase, H+ transporting, mitochondrial Fo complex, subunit s (factor B)
  • complement factor B-like
  • CFB
  • cfb
  • Bf
  • bfb-A
  • LOC397725
  • zgc:158446
  • bf/c2
  • Atp5s
  • Cfb
  • LOC100355944
Reactivity
Human
165
49
46
1
Host
Rabbit
116
57
16
7
Clonality
Polyclonal
Conjugate
This Complement Factor B antibody is un-conjugated
21
15
9
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
138
124
47
21
21
20
13
12
11
10
9
6
5
3
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4299963
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
9.142917 ABIN1871801 IHC WB Rabbit IgG Log in to see Polyclonal
9.142917 ABIN2404540 IHC WB Rabbit IgG Log in to see Polyclonal
9.142917 ABIN3015550 IHC WB Rabbit Log in to see Polyclonal
1 ABIN4299962 IHC IHC (p) SimWes WB Rabbit IgG Log in to see Polyclonal 4
1 ABIN4299964 IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN1175357 ICC IHC IP WB Rabbit IgG AA 270-388 Log in to see Polyclonal
1 ABIN1858375 ICC IHC IP WB Rabbit IgG AA 477-600 Log in to see Polyclonal
1 ABIN1858372 ICC IHC IP WB Rabbit IgG AA 35-160 Log in to see Polyclonal
1 ABIN255394 Func FACS IHC (fro) IHC ELISA WB Mouse IgG1 Log in to see 014III-33-2-4-3
1 ABIN255392 FACS IHC (fro) IHC ELISA WB Mouse IgG1 Log in to see 10-Sep
1 ABIN470821 ID IEP IHC Sheep IgG Log in to see Polyclonal
1 ABIN2879874 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2232233 FACS IHC ELISA WB FITC Rabbit IgG AA 469-494, Center, Internal Region Log in to see Polyclonal
1 ABIN268111 IHC (p) IHC Sheep Log in to see Polyclonal
1 ABIN2232229 FACS IHC ELISA WB Rabbit IgG AA 469-494, Center, Internal Region Log in to see Polyclonal
1 ABIN2887070 IHC WB Rabbit Log in to see Polyclonal
1 ABIN2237112 FACS IHC ELISA WB Mouse IgG1 Log in to see 10B2566
1 ABIN2237110 FACS IHC ELISA WB Mouse IgG1 Log in to see 10B2567
1 ABIN1814259 FACS IHC Rabbit AA 469-494 Log in to see Polyclonal
1 ABIN2619157 ID FACS IP IHC ELISA WB Goat Log in to see Polyclonal

Top referenced anti-Complement Factor B antibody for Immunohistochemistry

Similar anti-Complement Factor B Antibodies

Application / Reactivity Human
ELISA 99 Antibodies
Enzyme Immunoassay (EIA) 11 Antibodies
Flow Cytometry (FACS) 21 Antibodies
Functional Studies (Func) 6 Antibodies
Immunoassay (IA) 3 Antibodies
Immunocytochemistry (ICC) 4 Antibodies
Immunodiffusion (ID) 5 Antibodies
Immunoelectrophoresis (IEP) 1 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 3 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 33 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 12 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 22 Antibodies
Immunoprecipitation (IP) 14 Antibodies
Radioimmunoassay (RIA) 2 Antibodies
Simple Western (SimWes) 2 Antibodies
Western Blotting (WB) 107 Antibodies

General

Antigen Complement Factor B (CFB) Antibodies
Reactivity Human
(165), (49), (46), (1)
Host Rabbit
(116), (57), (16), (7)
Clonality
Polyclonal
Conjugate This Complement Factor B antibody is un-conjugated
(21), (15), (9), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(138), (124), (47), (21), (21), (20), (13), (12), (11), (10), (9), (6), (5), (3), (2), (2), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-Complement Factor B Antibody

Target Details Complement Factor B Application Details Handling References for anti-Complement Factor B Antibody (ABIN4299963) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKL
Isotype IgG

Target Details Complement Factor B

Product Details anti-Complement Factor B Antibody Application Details Handling References for anti-Complement Factor B Antibody (ABIN4299963) Images back to top
Antigen
Alternative Name Complement Factor B (CFB Antibody Abstract)
Background Gene Symbol: CFB
Gene ID 629
Pathways Complement System, Proton Transport, Ribonucleoside Biosynthetic Process

Application Details

Product Details anti-Complement Factor B Antibody Target Details Complement Factor B Handling References for anti-Complement Factor B Antibody (ABIN4299963) Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Complement Factor B Antibody Target Details Complement Factor B Application Details References for anti-Complement Factor B Antibody (ABIN4299963) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Complement Factor B Antibody (ABIN4299963)

Product Details anti-Complement Factor B Antibody Target Details Complement Factor B Application Details Handling Images back to top
Product cited in:

Kato, Nicholson, Neiman, Rantalainen, Holmes, Barrett, Uhlén, Nilsson, Spector, Schwenk: "Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model." in: Proteome science, Vol. 9, pp. 73, 2011

Singh, Kapoun, Higgins, Kutschke, Thurman, Zhang, Singh, Yang, Guan, Lowe, Weiss, Zimmermann, Yull, Blackwell, Mohler, Anderson: "Ca2+/calmodulin-dependent kinase II triggers cell membrane injury by inducing complement factor B gene expression in the mouse heart." in: The Journal of clinical investigation, Vol. 119, Issue 4, pp. 986-96, 2009

Images

Product Details anti-Complement Factor B Antibody Target Details Complement Factor B Application Details Handling References for anti-Complement Factor B Antibody (ABIN4299963) back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Complement Factor B antibody (CFB) (ABIN4299963) Immunohistochemistry: Complement Factor B Antibody [NBP1-89986] - Staining of human p...