AGO1 antibody (AA 376-409)
-
- Target See all AGO1 (EIF2C1) Antibodies
- AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))
-
Binding Specificity
- AA 376-409
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AGO1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)
- Purification
- Antigen affinity purified
- Immunogen
- Amino acids 376-409 (EISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGR) from the human protein were used as the immunogen for the AGO1 antibody.
- Isotype
- IgG
-
anti-Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1) (Internal Region) antibody
EIF2C1 Reactivity: Human, Mouse, Rat WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1) (AA 27-56), (N-Term) antibodyEIF2C1 Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal RB18965 unconjugated
anti-Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1) antibodyEIF2C1 Reactivity: Human, Mouse ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1) (C-Term) antibodyEIF2C1 Reactivity: Human WB, ELISA Host: Rabbit Polyclonal unconjugated
anti-Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1) (AA 1-180) antibodyEIF2C1 Reactivity: Human WB, IP Host: Rabbit Polyclonal unconjugated
anti-Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1) (AA 251-400) antibodyEIF2C1 Reactivity: Human ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1) (Internal Region) antibodyVerified EIF2C1 Reactivity: Human WB, ELISA, IHC Host: Goat Polyclonal unconjugated
anti-Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1) (N-Term) antibodyEIF2C1 Reactivity: Human, Mouse, Rat, Dog, Monkey, Cow, Horse, Rabbit, Guinea Pig, Pig, Xenopus laevis, Bat WB Host: Rabbit Polyclonal unconjugated
anti-Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1) (AA 27-56) antibodyEIF2C1 Reactivity: Human WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1) (N-Term) antibodyEIF2C1 Reactivity: Human, Mouse, Rat, Dog, Cow, Horse, Rabbit, Guinea Pig, Zebrafish (Danio rerio) WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
- Optimal dilution of the AGO1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells,IHC (FFPE): 1-2 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the AGO1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))
- Alternative Name
- AGO1 / Argonaute 1 (EIF2C1 Products)
- Synonyms
- Ago antibody, Ago-1 antibody, Ago1 antibody, CG6671 antibody, Dm Ago1 antibody, Dmel\\CG6671 antibody, MRE20 antibody, ago1 antibody, ago1-1 antibody, anon-WO0257455.29 antibody, dAGO1 antibody, dAgo1 antibody, l(2)04845 antibody, l(2)4845 antibody, l(2)k00208 antibody, l(2)k08121 antibody, GB12654 antibody, dsim_GLEANR_9718 antibody, DsimGD25729 antibody, GD25729 antibody, EIF2C1 antibody, EIF2C antibody, GERP95 antibody, Q99 antibody, Eif2c1 antibody, ARGONAUTE 1 antibody, T1N15.2 antibody, T1N15_2 antibody, Argonaute-1 antibody, protein argonaute-2 antibody, argonaute 1 antibody, Argonaute 1 antibody, protein argonaute-1 antibody, argonaute 1, RISC catalytic component antibody, argonaute RISC catalytic subunit 1 antibody, Stabilizer of iron transporter SufD / Polynucleotidyl transferase antibody, AGO1 antibody, LOC552062 antibody, ago1 antibody, LOC659936 antibody, Dsim\AGO1 antibody, Ago1 antibody, LOC100386910 antibody, LOC100482671 antibody, LOC475337 antibody
- Background
- This gene encodes a member of the argonaute family of proteins, which associate with small RNAs and have important roles in RNA interference (RNAi) and RNA silencing. This protein binds to microRNAs (miRNAs) or small interfering RNAs (siRNAs) and represses translation of mRNAs that are complementary to them. It is also involved in transcriptional gene silencing (TGS) of promoter regions that are complementary to bound short antigene RNAs (agRNAs), as well as in the degradation of miRNA-bound mRNA targets. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target, and that its mRNA could give rise to an additional C-terminally extended isoform by use of an alternative in-frame translation termination codon.
- UniProt
- Q9UL18
- Pathways
- Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Hormone Transport, Regulation of Actin Filament Polymerization, Stem Cell Maintenance, Ribonucleoprotein Complex Subunit Organization
-
