You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human IL12RB2 antibody for Immunohistochemistry

Recommended IL12RB2 Antibody (supplied by: Log in to see )

Antigen
Interleukin 12 Receptor, beta 2 (IL12RB2) Antibodies
  • IL12RB2
  • A930027I18Rik
  • IL-12RB2
  • Ifnm
  • interleukin 12 receptor, beta 2
  • IL12RB2
  • Il12rb2
Reactivity
Human
73
40
19
1
1
Host
Rabbit
64
22
Clonality
Polyclonal
Conjugate
This IL12RB2 antibody is un-conjugated
7
6
6
4
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
57
38
29
25
13
7
4
4
4
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4324489
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
9.181573 ABIN2434812 IHC ELISA Rabbit IgG Log in to see Polyclonal
9.181573 ABIN2433183 IHC ELISA Rabbit IgG Log in to see Polyclonal
1 ABIN1174180 ICC IHC IP WB Rabbit IgG AA 145-275 Log in to see Polyclonal
1 ABIN1859338 ICC IHC IP WB Rabbit IgG AA 559-647 Log in to see Polyclonal
1 ABIN1904912 FACS IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG AA 759-788 Log in to see Polyclonal
1 ABIN1904913 FACS IHC ELISA WB APC Rabbit IgG AA 759-788 Log in to see Polyclonal
1 ABIN1904914 FACS IHC ELISA WB Biotin Rabbit IgG AA 759-788 Log in to see Polyclonal
1 ABIN1904915 FACS IHC ELISA WB FITC Rabbit IgG AA 759-788 Log in to see Polyclonal
1 ABIN1904917 FACS IHC ELISA WB HRP Rabbit IgG AA 759-788 Log in to see Polyclonal
1 ABIN1904916 FACS IHC ELISA WB PE Rabbit IgG AA 759-788 Log in to see Polyclonal
1 ABIN2623881 ELISA FACS IHC WB Rabbit IgG AA 759-788 Log in to see Polyclonal
1 ABIN2290609 FACS IHC ELISA WB FITC Rabbit IgG AA 756-783, C-Term Log in to see Polyclonal
1 ABIN2290605 FACS IHC ELISA WB APC Rabbit IgG AA 756-783, C-Term Log in to see Polyclonal
1 ABIN2290612 IHC ELISA WB HRP Rabbit IgG AA 756-783, C-Term Log in to see Polyclonal
1 ABIN2290614 FACS IHC ELISA WB PE Rabbit IgG AA 756-783, C-Term Log in to see Polyclonal
1 ABIN2290597 FACS IHC ELISA WB Rabbit IgG AA 756-783, C-Term Log in to see Polyclonal
1 ABIN2290607 FACS IHC ELISA WB Biotin Rabbit IgG AA 756-783, C-Term Log in to see Polyclonal
1 ABIN2290603 FACS IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG AA 756-783, C-Term Log in to see Polyclonal
1 ABIN1174182 IHC ELISA WB Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN2935349 ELISA IF/ICC IHC WB Rabbit AA 559-647 Log in to see Polyclonal

Similar anti-IL12RB2 Antibodies

Application / Reactivity Human
ELISA 28 Antibodies
ELISA (Capture) 1 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Flow Cytometry (FACS) 29 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 2 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 22 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 8 Antibodies
Immunoprecipitation (IP) 2 Antibodies
Western Blotting (WB) 46 Antibodies

General

Antigen Interleukin 12 Receptor, beta 2 (IL12RB2) Antibodies
Reactivity Human
(73), (40), (19), (1), (1)
Host Rabbit
(64), (22)
Clonality
Polyclonal
Conjugate This IL12RB2 antibody is un-conjugated
(7), (6), (6), (4), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(57), (38), (29), (25), (13), (7), (4), (4), (4), (2), (1)
Supplier Log in to see

Product Details anti-IL12RB2 Antibody

Target Details IL12RB2 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:WKNLSVSEARGKILHYQVTLQELTGGKAMTQNITGHTSWTTVIPRTGNWAVAVSAANSKGSSLPTRINIMNLCEAGLLAPRQVSANSEGMDNILVTWQPPRKDPSAV
Isotype IgG

Target Details IL12RB2

Product Details anti-IL12RB2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name IL-12 R beta 2 (IL12RB2 Antibody Abstract)
Background Gene Symbol: IL12RB2
Gene ID 3595
UniProt Q99665
Pathways JAK-STAT Signaling

Application Details

Product Details anti-IL12RB2 Antibody Target Details IL12RB2 Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-IL12RB2 Antibody Target Details IL12RB2 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-IL12RB2 Antibody Target Details IL12RB2 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-IL12RB2 antibody (Interleukin 12 Receptor, beta 2) (ABIN4324489) Immunohistochemistry: IL-12 R beta 2 Antibody [NBP1-85983] - Staining of human cerebr...