You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human IL21 antibody for Immunohistochemistry

Recommended IL21 Antibody (supplied by: Log in to see )

Antigen
Interleukin 21 (IL21) Antibodies
  • IL-21
  • Za11
Epitope
N-Term
26
18
14
13
11
8
8
6
4
3
3
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
Reactivity
Human
199
90
22
8
5
5
Host
Goat
161
66
30
10
5
Clonality
Polyclonal
Conjugate
This IL21 antibody is un-conjugated
19
15
9
8
8
8
6
6
5
5
4
4
3
3
3
3
3
2
2
2
2
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (IHC), ELISA
182
128
41
19
17
14
11
11
7
6
6
4
3
2
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN449981
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.20586085 ABIN3198158 IC IF IHC WB Rabbit Log in to see Polyclonal
0.20586085 ABIN2490863 IHC ELISA WB Rabbit AA 97-111 Log in to see Polyclonal
0.20586085 ABIN2487947 FACS IHC ELISA WB Rabbit Ig Fraction Log in to see Polyclonal
0.20586085 ABIN1030836 IHC ELISA WB Rabbit Extracellular Domain Log in to see Polyclonal
0.001128484 ABIN315232 ICC IF IHC IHC (fro) IHC (p) WB Rabbit Center Log in to see Polyclonal 4
0.001128484 ABIN342791 ICC IHC ELISA Goat N-Term Log in to see Polyclonal
0.001128484 ABIN2563408 IF IHC WB Rabbit IgG Log in to see Polyclonal
0.001128484 ABIN1174931 ICC IF IHC WB FITC Rabbit IgG Log in to see Polyclonal
0.001128484 ABIN2755384 IHC ELISA Rabbit IgG AA 25-162 Log in to see Polyclonal
0.001128484 ABIN2290116 IHC WB Rabbit IgG Log in to see Polyclonal
0.001128484 ABIN2288630 IHC WB Rabbit IgG Log in to see Polyclonal
0.001128484 ABIN2970690 ICC IF IHC WB Rabbit IgG Log in to see Polyclonal
0.001128484 ABIN2288619 IHC WB Rabbit Log in to see Polyclonal
0.001128484 ABIN2793566 FACS IHC WB Rabbit Ig Fraction Log in to see Polyclonal

Top referenced anti-IL21 antibody for Immunohistochemistry

  • Human Polyclonal IL21 Primary Antibody for ICC, IF - ABIN315232 (4 Publications): Liu, Xia, Wu, Wu, Tang, Chen, Xu, Cong, Xu, Liu: Anti-tumour necrosis factor therapy enhances mucosal healing through down-regulation of interleukin-21 expression and T helper type 17 cell infiltration in Crohn's disease. in Clinical and experimental immunology 2013 (PubMed)

Similar anti-IL21 Antibodies

Application / Reactivity Human
Biochemical Assay (BCA) 4 Antibodies
ELISA 92 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Flow Cytometry (FACS) 11 Antibodies
Immunochromatography (IC) 4 Antibodies
Immunocytochemistry (ICC) 17 Antibodies
Immunofluorescence (IF) 11 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies
Immunohistochemistry (IHC) 15 Antibodies
Immunohistochemistry (Acetone-fixed) (IHC (af)) 2 Antibodies
Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (fp)) 1 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 4 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 13 Antibodies
Intracellular Flow Cytometry (ICFC) 2 Antibodies

General

Antigen Interleukin 21 (IL21) Antibodies
Epitope N-Term
(26), (18), (14), (13), (11), (8), (8), (6), (4), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human
(199), (90), (22), (8), (5), (5)
Host Goat
(161), (66), (30), (10), (5)
Clonality
Polyclonal
Conjugate This IL21 antibody is un-conjugated
(19), (15), (9), (8), (8), (8), (6), (6), (5), (5), (4), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (IHC), ELISA
(182), (128), (41), (19), (17), (14), (11), (11), (7), (6), (6), (4), (3), (2), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-IL21 Antibody

Target Details IL21 Application Details Handling Images
Specificity Human IL-21
Purification Immunogen affinity purified
Immunogen Synthetic peptide 78 CFQKAQLKSANTGNNERIINVSIKKLKRKPPS 109 corresponding to N-terminus region of human IL-21
Isotype IgG

Target Details IL21

Product Details anti-IL21 Antibody Application Details Handling Images back to top
Antigen
Alternative Name IL-21 (IL21 Antibody Abstract)
Background Gene Symbol: IL21
Gene ID 59067
UniProt Q9HBE4
Research Area Immunology, Cytokines, Inflammation, Virology, Cancer
Pathways JAK-STAT Signaling

Application Details

Product Details anti-IL21 Antibody Target Details IL21 Handling Images back to top
Application Notes ELISA 1:50000, Immunohistochemistry 1:250, Immunohistochemistry-Paraffin 1:250
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-IL21 Antibody Target Details IL21 Application Details Images back to top
Format Liquid
Concentration 1.0 mg/mL
Buffer 10 mM KHPO4, 140 mM NaCl
Buffer contains: 0.1 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid freeze-thaw cycles
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.

Images

Product Details anti-IL21 Antibody Target Details IL21 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-IL21 antibody (Interleukin 21) (N-Term) (ABIN449981) Immunohistochemistry: IL-21 Antibody [NBP1-30074] - Human spleen human IL-21