anti-Mouse (Murine) IL21 antibody for Immunochromatography

Recommended IL21 Antibody (supplied by: Log in to see )

Antigen
Interleukin 21 (IL21) Antibodies
  • IL-21
  • Za11
  • interleukin 21
  • interleukin 21-like
  • IL21
  • Il21
  • LOC100344172
Epitope
N-Term
23
18
15
13
8
7
6
6
6
6
3
3
3
3
3
3
2
2
2
2
2
1
1
1
1
1
1
1
1
Reactivity
Mouse (Murine)
204
102
24
10
5
5
4
1
1
Host
Goat
166
70
41
10
5
Clonality
Polyclonal
Conjugate
This IL21 antibody is un-conjugated
20
15
11
10
9
8
6
6
5
5
5
5
3
3
3
3
3
3
3
3
3
3
1
1
1
1
1
1
Application
Immunochromatography (IC), ELISA
187
132
49
39
34
26
15
13
7
5
5
4
4
4
3
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Catalog No. ABIN2288620
$ 586.14
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN2288622 IC ELISA Rabbit IgG C-Term Log in to see Polyclonal

General

Antigen Interleukin 21 (IL21) Antibodies
Epitope N-Term
(23), (18), (15), (13), (8), (7), (6), (6), (6), (6), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Mouse (Murine)
(204), (102), (24), (10), (5), (5), (4), (1), (1)
Host Goat
(166), (70), (41), (10), (5)
Clonality
Polyclonal
Conjugate This IL21 antibody is un-conjugated
(20), (15), (11), (10), (9), (8), (6), (6), (5), (5), (5), (5), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (1), (1), (1), (1), (1), (1)
Application Immunochromatography (IC), ELISA
(187), (132), (49), (39), (34), (26), (15), (13), (7), (5), (5), (4), (4), (4), (3), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-IL21 Antibody

Target Details IL21 Application Details Handling Images
Sequence CRHLIDIVEQ LKIYENDLDP ELLSAPQDVK
Cross-Reactivity Mouse (Murine)
Cross-Reactivity (Details) Calculated cross reactivity: Mo
Characteristics Interleukin 21 (IL-21), NT
Purification Purified by immunoaffinity chromatography.
Immunogen Synthetic peptide CRHLIDIVEQLKIYENDLDPELLSAPQDVK corresponding to N-terminus of mouse IL-21.
Isotype IgG

Target Details IL21

Product Details anti-IL21 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Interleukin 21 (IL21 Antibody Abstract)
Pathways JAK-STAT Signaling, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response

Application Details

Product Details anti-IL21 Antibody Target Details IL21 Handling Images back to top
Application Notes Optimal working conditions should be determined by the investigator.
Restrictions For Research Use only

Handling

Product Details anti-IL21 Antibody Target Details IL21 Application Details Images back to top
Format Liquid
Buffer Supplied as a liquid in PBS, pH 7.2, 0.09 % sodium azide before the addition of 40 % glycerol.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment -20°C