anti-Mouse (Murine) IL21 antibody for Immunochromatography

Recommended IL21 Antibody (supplied by: Log in to see )

Interleukin 21 (IL21) Antibodies
  • IL-21
  • Za11
  • interleukin 21
  • interleukin 21-like
  • IL21
  • Il21
  • LOC100344172
Mouse (Murine)
This IL21 antibody is un-conjugated
Immunochromatography (IC), ELISA
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Catalog No. ABIN2288620
$ 586.14
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN2288622 IC ELISA Rabbit IgG C-Term Log in to see Polyclonal

Similar anti-IL21 Antibodies

Application / Reactivity Mouse (Murine)
Biochemical Assay (BCA) 1 Antibodies
Blocking Antibody (Inhibition) 1 Antibodies
Cytometry by Time of Flight (CyTOF) 1 Antibodies
ELISA 38 Antibodies
Flow Cytometry (FACS) 36 Antibodies
Immunochromatography (IC) 2 Antibodies
Immunocytochemistry (ICC) 3 Antibodies
Immunofluorescence (IF) 2 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 8 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 2 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 5 Antibodies
Immunoprecipitation (IP) 1 Antibodies
Intracellular Flow Cytometry (ICFC) 3 Antibodies
Western Blotting (WB) 46 Antibodies


Antigen Interleukin 21 (IL21) Antibodies
Epitope N-Term
(23), (18), (15), (13), (8), (7), (6), (6), (6), (6), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Mouse (Murine)
(201), (97), (24), (9), (5), (5), (4), (1), (1)
Host Goat
(164), (68), (36), (10), (5)
Conjugate This IL21 antibody is un-conjugated
(19), (15), (10), (9), (9), (8), (6), (6), (5), (5), (5), (5), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Application Immunochromatography (IC), ELISA
(181), (128), (46), (39), (33), (25), (15), (13), (7), (5), (5), (4), (4), (4), (3), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-IL21 Antibody

Target Details IL21 Application Details Handling Images
Cross-Reactivity Mouse (Murine)
Cross-Reactivity (Details) Calculated cross reactivity: Mo
Characteristics Interleukin 21 (IL-21), NT
Purification Purified by immunoaffinity chromatography.
Immunogen Synthetic peptide CRHLIDIVEQLKIYENDLDPELLSAPQDVK corresponding to N-terminus of mouse IL-21.
Isotype IgG

Target Details IL21

Product Details anti-IL21 Antibody Application Details Handling Images back to top
Alternative Name Interleukin 21 (IL21 Antibody Abstract)
Pathways JAK-STAT Signaling, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response

Application Details

Product Details anti-IL21 Antibody Target Details IL21 Handling Images back to top
Application Notes Optimal working conditions should be determined by the investigator.
Restrictions For Research Use only


Product Details anti-IL21 Antibody Target Details IL21 Application Details Images back to top
Format Liquid
Buffer Supplied as a liquid in PBS, pH 7.2, 0.09 % sodium azide before the addition of 40 % glycerol.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment -20°C