You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) IL21 antibody for Immunochromatography

Recommended IL21 Antibody (supplied by: Log in to see )

Antigen
Interleukin 21 (IL21) Antibodies
  • IL-21
  • Za11
Epitope
N-Term
26
14
13
11
9
8
8
6
4
3
3
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Mouse (Murine)
206
87
22
8
5
5
Host
Goat
161
72
28
10
5
Clonality
Polyclonal
Conjugate
This IL21 antibody is un-conjugated
20
16
9
9
8
8
6
4
4
4
3
3
3
3
3
3
3
3
3
2
2
2
2
1
1
1
1
1
1
Application
Immunochromatography (IC), ELISA
184
128
40
19
18
15
11
10
8
7
6
5
4
3
2
2
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Catalog No. ABIN2288620
$ 564.14
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.0008709465 ABIN2288622 IC ELISA Rabbit IgG C-Term Log in to see Polyclonal

Similar anti-IL21 Antibodies

Application / Reactivity Mouse (Murine)
Biochemical Assay (BCA) 1 Antibodies
Blocking Antibody (Inhibition) 1 Antibodies
ELISA 40 Antibodies
Flow Cytometry (FACS) 27 Antibodies
Immunochromatography (IC) 2 Antibodies
Immunocytochemistry (ICC) 3 Antibodies
Immunofluorescence (IF) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies
Immunohistochemistry (IHC) 6 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 3 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 6 Antibodies
Intracellular Flow Cytometry (ICFC) 3 Antibodies
Intracellular Staining (ICS) 5 Antibodies
Neutralization (Neut) 1 Antibodies
Western Blotting (WB) 48 Antibodies

General

Antigen Interleukin 21 (IL21) Antibodies
Epitope N-Term
(26), (14), (13), (11), (9), (8), (8), (6), (4), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Mouse (Murine)
(206), (87), (22), (8), (5), (5)
Host Goat
(161), (72), (28), (10), (5)
Clonality
Polyclonal
Conjugate This IL21 antibody is un-conjugated
(20), (16), (9), (9), (8), (8), (6), (4), (4), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Application Immunochromatography (IC), ELISA
(184), (128), (40), (19), (18), (15), (11), (10), (8), (7), (6), (5), (4), (3), (2), (2), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-IL21 Antibody

Target Details IL21 Application Details Handling Images
Sequence CRHLIDIVEQ LKIYENDLDP ELLSAPQDVK
Cross-Reactivity Mouse (Murine)
Cross-Reactivity (Details) Calculated cross reactivity: Mo
Characteristics Interleukin 21 (IL-21), NT
Purification Purified by immunoaffinity chromatography.
Immunogen Synthetic peptide CRHLIDIVEQLKIYENDLDPELLSAPQDVK corresponding to N-terminus of mouse IL-21.
Isotype IgG

Target Details IL21

Product Details anti-IL21 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Interleukin 21 (IL21 Antibody Abstract)
Pathways JAK-STAT Signaling

Application Details

Product Details anti-IL21 Antibody Target Details IL21 Handling Images back to top
Application Notes Optimal working conditions should be determined by the investigator.
Restrictions For Research Use only

Handling

Product Details anti-IL21 Antibody Target Details IL21 Application Details Images back to top
Format Liquid
Buffer Supplied as a liquid in PBS, pH 7.2, 0.09 % sodium azide before the addition of 40 % glycerol.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment -20°C