You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) IL21 antibody for Immunocytochemistry

Recommended IL21 Antibody (supplied by: Log in to see )

Antigen
Interleukin 21 (IL21) Antibodies
  • IL-21
  • Za11
Epitope
N-Term, AA 32-61
26
14
13
10
9
8
8
5
4
3
3
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Mouse (Murine)
204
86
21
8
5
5
Host
Goat
160
72
28
9
5
Clonality
Polyclonal
Conjugate
This IL21 antibody is un-conjugated
20
16
9
9
8
8
6
4
4
4
3
3
3
3
3
3
3
3
3
2
2
2
2
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), ELISA
183
127
40
18
15
13
11
9
8
7
6
5
4
3
2
2
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN152155
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.0010194078 ABIN1868626 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG Log in to see Polyclonal
0.0010194078 ABIN1868628 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG Log in to see Polyclonal

Similar anti-IL21 Antibodies

Application / Reactivity Mouse (Murine)
Biochemical Assay (BCA) 1 Antibodies
Blocking Antibody (Inhibition) 1 Antibodies
ELISA 40 Antibodies
Flow Cytometry (FACS) 27 Antibodies
Immunochromatography (IC) 2 Antibodies
Immunocytochemistry (ICC) 3 Antibodies
Immunofluorescence (IF) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies
Immunohistochemistry (IHC) 4 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 2 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 5 Antibodies
Intracellular Flow Cytometry (ICFC) 3 Antibodies
Intracellular Staining (ICS) 5 Antibodies
Neutralization (Neut) 1 Antibodies
Western Blotting (WB) 47 Antibodies

General

Antigen Interleukin 21 (IL21) Antibodies
Epitope N-Term, AA 32-61
(26), (14), (13), (10), (9), (8), (8), (5), (4), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Mouse (Murine)
(204), (86), (21), (8), (5), (5)
Host Goat
(160), (72), (28), (9), (5)
Clonality
Polyclonal
Conjugate This IL21 antibody is un-conjugated
(20), (16), (9), (9), (8), (8), (6), (4), (4), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), ELISA
(183), (127), (40), (18), (15), (13), (11), (9), (8), (7), (6), (5), (4), (3), (2), (2), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-IL21 Antibody

Target Details IL21 Application Details Handling Images
Specificity Peptide sequence is < 50 % identical to other interleukins in this region and is therefore not expected to cross-react.
Cross-Reactivity (Details) Expected to cross-react with rat,(93% identity with immunogen) due to sequence homology.
Purification affinity purified
Immunogen Synthetic peptide: CRHLIDIVEQLKIYENDLDPELLSAPQDVK , corresponding to N terminal amino acids 32-61 of Mouse IL21.

Target Details IL21

Product Details anti-IL21 Antibody Application Details Handling Images back to top
Antigen
Alternative Name IL-21 (IL21 Antibody Abstract)
Background A novel cytokine related to IL2 and IL15 was recently identified and designated IL21.IL21 has been found to be a powerful growth factor for naive B cells. The receptor forIL21 (IL21R, also termed NILR for novel Interleukin receptor) is a new member of theclass I cytokine receptor family. IL21R forms a complex with the common cytokinereceptor g chain, gc, and mediates IL21 signaling. Both IL21R and the gc are necessaryfor the IL21 function. IL21 and its receptor activate JAKSTAT signaling pathway. IL21Ris expressed in spleen, thymus, natural killer (NK), T and B cell lines. IL21 plays a role inthe proliferation and maturation of NK, B and T cell populations. Alternate Names: anti-IL 21 antibody, anti-IL21 antibody, anti-Interleukin 21 antibody, anti-Interleukin21antibody, anti-Za11 antibody.
Gene Symbol: IL21
Gene ID 59067
Pathways JAK-STAT Signaling

Application Details

Product Details anti-IL21 Antibody Target Details IL21 Handling Images back to top
Application Notes Recommended dilutions: ELISA 1:100-1:2000, Immunocytochemistry/Immunofluorescence 1:500
Restrictions For Research Use only

Handling

Product Details anti-IL21 Antibody Target Details IL21 Application Details Images back to top
Concentration 1.0 mg/mL
Buffer 140 mM Sodium chloride, 140 mM Potassium Phosphate [pH 7], Sodium Azide
Preservative Sodium azide
Precaution of Use WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.
Handling Advice Avoid freeze-thaw cycles
Storage 4 °C
Storage Comment 4 °C short term. Aliquot and store at -20 °C long term.

Images

Product Details anti-IL21 Antibody Target Details IL21 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-IL21 antibody (Interleukin 21) (N-Term) (ABIN152155) Immunohistochemistry with goat antibody N-terminus of mouse IL-21.