You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human IL21 Receptor antibody for Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections)

Recommended IL21 Receptor Antibody (supplied by: Log in to see )

Interleukin 21 Receptor (IL21R) Antibodies
  • CD360
  • il-21ra.a
  • IL21R
  • NILR
AA 35-65, N-Term
This IL21 Receptor antibody is un-conjugated
Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (fp)), ELISA
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN2487948
$ 650.00
Plus shipping costs $45.00

Similar anti-IL21 Receptor Antibodies

Application / Reactivity Human
Biochemical Assay (BCA) 4 Antibodies
ELISA 31 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Flow Cytometry (FACS) 14 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (IF) 3 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies
Immunohistochemistry (IHC) 17 Antibodies
Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (fp)) 1 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 13 Antibodies
Immunoprecipitation (IP) 2 Antibodies
Mass Cytometry (CyTOF) 1 Antibodies
Western Blotting (WB) 51 Antibodies


Antigen Interleukin 21 Receptor (IL21R) Antibodies
Epitope AA 35-65, N-Term
(13), (12), (11), (8), (7), (4), (3), (2), (2), (1), (1), (1)
Reactivity Human
(92), (51), (30), (2)
Host Goat
(73), (22), (15), (5)
Conjugate This IL21 Receptor antibody is un-conjugated
(8), (6), (6), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (fp)), ELISA
(53), (38), (29), (22), (14), (11), (4), (4), (2), (2), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-IL21 Receptor Antibody

Target Details IL21 Receptor Application Details Handling Images
Specificity IL-21 RECEPTOR
Cross-Reactivity Human
Predicted Reactivity Human
Protein size: 538
Immunogen The immunogen for anti-IL21R antibody: synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to AA 35-65 within the N-terminal region of human IL-21R.
Isotype IgG

Target Details IL21 Receptor

Product Details anti-IL21 Receptor Antibody Application Details Handling Images back to top
Alternative Name IL21R (IL21R Antibody Abstract)
Gene ID 50615
NCBI Accession NP_068570
UniProt Q9HBE5
Research Area Cytokines, Receptors, Inflammation
Pathways JAK-STAT Signaling

Application Details

Product Details anti-IL21 Receptor Antibody Target Details IL21 Receptor Handling Images back to top
Application Notes ELISA : This product is suitable for use in indirect ELISA applications.
Restrictions For Research Use only


Product Details anti-IL21 Receptor Antibody Target Details IL21 Receptor Application Details Images back to top
Format Liquid
Handling Advice Avoid repeat freeze-thaw cycles.
Should this product contain a precipitate we recommend microcentrifugation before use.
Storage -20 °C
Storage Comment Store at -20 °C only.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.


Product Details anti-IL21 Receptor Antibody Target Details IL21 Receptor Application Details Handling back to top
Supplier Images
Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (fp)) image for anti-IL21 Receptor antibody (Interleukin 21 Receptor) (AA 35-65) (ABIN2487948) anti-Interleukin 21 Receptor (IL21R) (AA 35-65), (N-Term) antibody