anti-Rat (Rattus) Leptin Receptor antibody for ELISA

Recommended Leptin Receptor Antibody (supplied by: Log in to see )

Antigen
Leptin Receptor (LEPR) Antibodies
  • obr
  • cd295
  • ob-rb
  • CD295
  • LEP-R
  • LEPRD
  • OB-R
  • OBR
  • ObRb
  • LEPROT
  • Leprb
  • Modb1
  • OB-RGRP
  • Obr
  • db
  • diabetes
  • obese-like
  • obl
  • Ob-R
  • Ob-RM
  • Fa
  • LEPR
  • Obrgrp
  • VPS55
  • leptin receptor
  • leptin receptor overlapping transcript
  • Leptin receptor-like
  • leptin receptor-like
  • lepr
  • LEPR
  • Lepr
  • Leprot
  • LOC100351924
  • LOC100069504
Epitope
AA 793-839, C-Term
24
19
16
15
15
14
13
6
5
5
5
5
5
4
4
4
3
3
3
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
224
94
61
15
6
2
2
1
1
1
1
1
Host
Rabbit
148
69
27
16
2
1
Clonality
Polyclonal
Conjugate
This Leptin Receptor antibody is un-conjugated
12
10
10
7
7
7
6
5
5
5
5
4
4
3
3
3
3
3
3
2
2
2
2
2
2
2
1
1
Application
ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
166
104
73
50
40
40
6
4
4
3
3
2
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Catalog No. ABIN5518771
$ 200.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1582193 IHC ELISA WB Rabbit Log in to see Polyclonal 3
1 ABIN233311 ELISA WB Rabbit IgG AA 577-594 Log in to see Polyclonal
1 ABIN2299791 ELISA WB Rabbit IgG AA 577-594 Log in to see Polyclonal
1 ABIN2431585 IHC ELISA Rabbit IgG Log in to see Polyclonal

General

Antigen Leptin Receptor (LEPR) Antibodies
Epitope AA 793-839, C-Term
(24), (19), (16), (15), (15), (14), (13), (6), (5), (5), (5), (5), (5), (4), (4), (4), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(224), (94), (61), (15), (6), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(148), (69), (27), (16), (2), (1)
Clonality
Polyclonal
Conjugate This Leptin Receptor antibody is un-conjugated
(12), (10), (10), (7), (7), (7), (6), (5), (5), (5), (5), (4), (4), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1)
Application ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(166), (104), (73), (50), (40), (40), (6), (4), (4), (3), (3), (2), (2), (1)
Supplier Log in to see

Product Details anti-Leptin Receptor Antibody

Target Details Leptin Receptor Application Details Handling Images
Purpose Rabbit IgG polyclonal antibody for Leptin receptor(LEPR) detection. Tested with IHC-P, ELISA in Human,Mouse,Rat.
Sequence KKYYIHDHFI PIEKYQFSLY PIFMEGVGKP KIINSFTQDD IEKHQSD
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Leptin receptor(LEPR) detection. Tested with IHC-P, ELISA in Human,Mouse,Rat.
Gene Name: leptin receptor
Protein Name: Leptin receptor
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Leptin Receptor (793-839aa KKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDDIEKHQSD), different from the related mouse sequence by nine amino acids, and from the related rat sequence by eight amino acids.
Isotype IgG

Target Details Leptin Receptor

Product Details anti-Leptin Receptor Antibody Application Details Handling Images back to top
Antigen
Alternative Name LEPR (LEPR Antibody Abstract)
Background Leptin receptor, also known as LEP-R or OB-R is a protein that in humans is encoded by the LEPR gene. The protein encoded by this gene belongs to the gp130 family of cytokine receptors that are known to stimulate gene transcription via activation of cytosolic STAT proteins. This protein is a receptor for leptin (an adipocyte-specific hormone that regulates body weight), and is involved in the regulation of fat metabolism, as well as in a novel hematopoietic pathway that is required for normal lymphopoiesis. Mutations in this gene have been associated with obesity and pituitary dysfunction. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Synonyms: CD295 | DB | OBR | Fa | Obr | HuB219 | LEP R | LEPR | LEP-R | LEPRD | LEPROT | Leptin receptor | OB R | OB receptor | OB-R | OBRGRP | OB-RGRP | P48357
Gene ID 3953
UniProt P48357
Pathways JAK-STAT Signaling, AMPK Signaling, Feeding Behaviour

Application Details

Product Details anti-Leptin Receptor Antibody Target Details Leptin Receptor Handling Images back to top
Application Notes IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human

Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.
Comment

Antibody can be supported by ABIN921231 in IHC(P).

Restrictions For Research Use only

Handling

Product Details anti-Leptin Receptor Antibody Target Details Leptin Receptor Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.