anti-Rat (Rattus) STAT3 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended STAT3 Antibody (supplied by: Log in to see )

Antigen
Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3) Antibodies
  • 1110034C02Rik
  • AW109958
  • Aprf
  • APRF
  • HIES
  • Xstat3
  • aprf
  • hies
  • stat3
  • wu:fc15d02
  • wu:fl59g06
  • z-Stat3
  • signal transducer and activator of transcription 3 (acute-phase response factor)
  • signal transduction and activation of transcription 3
  • signal transducer and activator of transcription 3
  • signal transducer and activator of transcription 3 (acute-phase response factor), gene 1
  • STAT3
  • stat3
  • Stat3
  • stat3.1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
606
351
274
40
37
33
29
16
11
10
7
5
5
5
4
3
3
2
1
1
1
1
1
Host
Rabbit
476
136
34
5
2
1
Clonality
Polyclonal
Conjugate
This STAT3 antibody is un-conjugated
28
24
19
14
12
11
9
6
4
4
4
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
555
244
227
90
84
84
62
54
27
12
12
9
8
6
5
3
3
3
2
2
2
2
2
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4356373
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.569977 ABIN256760 ICC IF IHC (p) IHC ELISA WB Goat C-Term Log in to see Polyclonal 1
11.569977 ABIN732638 FACS IF (p) IHC (p) WB Rabbit IgG AA 685-725, pTyr705 Log in to see Polyclonal 4
11.569977 ABIN738261 FACS IF (p) IHC (p) WB Rabbit IgG AA 260-310 Log in to see Polyclonal 3
11.569977 ABIN1109149 IF IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal
11.569977 ABIN498896 IHC (p) WB Rabbit Log in to see Polyclonal
11.569977 ABIN498805 IHC (p) WB Rabbit pSer727 Log in to see Polyclonal
11.569977 ABIN5557530 IF (cc) IHC (p) WB Rabbit IgG pSer727 Log in to see 4G1
11.569977 ABIN5557539 IF (cc) IHC (p) WB Rabbit IgG Log in to see 6G5
1 ABIN3044335 ICC IHC (p) WB Rabbit IgG AA 686-698, C-Term Log in to see Polyclonal 8
1 ABIN746198 IF (p) IHC (p) WB Rabbit IgG AA 710-740, pSer727 Log in to see Polyclonal 1
1 ABIN197176 IHC (p) WB Rabbit AA 725-729 Log in to see Polyclonal 5
1 ABIN5552647 EIA IF IHC (p) WB Goat C-Term, Isoform 1 Log in to see Polyclonal
1 ABIN604667 IHC (p) WB Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN604780 IHC (p) WB Rabbit AA 683-732 Log in to see Polyclonal
1 ABIN1804660 IHC (p) IP WB Rabbit C-Term Log in to see Polyclonal
1 ABIN2888530 IHC (p) IP ELISA WB Rabbit IgG pSer727 Log in to see Polyclonal
1 ABIN2888531 IHC (p) IP ELISA WB Rabbit IgG pTyr705 Log in to see Polyclonal
1 ABIN2889068 IHC (p) ELISA WB Rabbit IgG AA 672-721 Log in to see Polyclonal
1 ABIN1492923 ICC IHC (p) WB Rabbit C-Term Log in to see Polyclonal
1 ABIN318127 IHC (p) IP WB Rabbit pTyr705 Log in to see Polyclonal

General

Antigen Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(606), (351), (274), (40), (37), (33), (29), (16), (11), (10), (7), (5), (5), (5), (4), (3), (3), (2), (1), (1), (1), (1), (1)
Host Rabbit
(476), (136), (34), (5), (2), (1)
Clonality
Polyclonal
Conjugate This STAT3 antibody is un-conjugated
(28), (24), (19), (14), (12), (11), (9), (6), (4), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(555), (244), (227), (90), (84), (84), (62), (54), (27), (12), (12), (9), (8), (6), (5), (3), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-STAT3 Antibody

Target Details STAT3 Application Details Handling ProductDetails: References for anti-STAT3 antibody (ABIN4356373) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECA
Isotype IgG

Target Details STAT3

Product Details anti-STAT3 Antibody Application Details Handling ProductDetails: References for anti-STAT3 antibody (ABIN4356373) Images back to top
Antigen
Alternative Name STAT3 (STAT3 Antibody Abstract)
Background Gene Symbol: STAT3
Molecular Weight Theoretical MW: 88 kDa
Gene ID 6774
UniProt P40763
Research Area Signaling, Embryogenesis, Receptors, Transcription Factors, Inflammation, Embryonic stem cells
Pathways JAK-STAT Signaling, RTK Signaling, Interferon-gamma Pathway, Neurotrophin Signaling Pathway, Dopaminergic Neurogenesis, Response to Growth Hormone Stimulus, Carbohydrate Homeostasis, Stem Cell Maintenance, Hepatitis C, Protein targeting to Nucleus, Feeding Behaviour, CXCR4-mediated Signaling Events, Signaling of Hepatocyte Growth Factor Receptor

Application Details

Product Details anti-STAT3 Antibody Target Details STAT3 Handling ProductDetails: References for anti-STAT3 antibody (ABIN4356373) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation/permeabilization: PFA/Triton X-100. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-STAT3 Antibody Target Details STAT3 Application Details ProductDetails: References for anti-STAT3 antibody (ABIN4356373) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-STAT3 antibody (ABIN4356373)

Product Details anti-STAT3 Antibody Target Details STAT3 Application Details Handling Images back to top
Product cited in:

Kjellin, Johansson, Höög, Lehtiö, Jakobsson, Kjellman: "Differentially expressed proteins in malignant and benign adrenocortical tumors." in: PLoS ONE, Vol. 9, Issue 2, pp. e87951, 2014

Stadler, Rexhepaj, Singan, Murphy, Pepperkok, Uhlén, Simpson, Lundberg: "Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells." in: Nature methods, Vol. 10, Issue 4, pp. 315-23, 2013

Images

Product Details anti-STAT3 Antibody Target Details STAT3 Application Details Handling ProductDetails: References for anti-STAT3 antibody (ABIN4356373) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3) antibody (ABIN4356373) Immunohistochemistry-Paraffin: STAT3 Antibody - Staining of human placenta shows str...
Western Blotting (WB) image for anti-Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3) antibody (ABIN4356373) Western Blot: STAT3 Antibody - Analysis in mouse cell line NIH-3T3 and rat cell line...
Western Blotting (WB) image for anti-Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3) antibody (ABIN4356373) Western Blot: STAT3 Antibody - Analysis in human cell line A-549.
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3) antibody (ABIN4356373) Immunohistochemistry-Paraffin: STAT3 Antibody - Staining of human cerebral cortex sh...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3) antibody (ABIN4356373) Immunohistochemistry-Paraffin: STAT3 Antibody - Staining of human kidney shows moder...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3) antibody (ABIN4356373) Immunohistochemistry-Paraffin: STAT3 Antibody - Staining of human placenta shows str...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3) antibody (ABIN4356373) Immunohistochemistry-Paraffin: STAT3 Antibody - Staining of human rectum shows moder...
Immunofluorescence (IF) image for anti-Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3) antibody (ABIN4356373) Immunocytochemistry/Immunofluorescence: STAT3 Antibody - Immunofluorescent staining ...