You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human HSF4 antibody for Immunofluorescence

Recommended HSF4 Antibody (supplied by: Log in to see )

Heat Shock Transcription Factor 4 (HSF4) Antibodies
  • CTM
  • CTRCT5
  • HSF 4
  • HSTF 4
  • HSTF4
  • ldis1
  • mHSF4
  • ZNF
  • Zfp46
  • heat shock transcription factor 4
  • zinc finger protein 436
  • HSF4
  • Hsf4
  • ZNF436
This HSF4 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN5077389
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN2469579 IF IHC ELISA WB Rabbit Log in to see Polyclonal

Similar anti-HSF4 Antibodies

Application / Reactivity Human
Cytometry by Time of Flight (CyTOF) 1 Antibodies
ELISA 43 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Flow Cytometry (FACS) 7 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (IF) 2 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunohistochemistry (IHC) 4 Antibodies
Immunoprecipitation (IP) 1 Antibodies
Western Blotting (WB) 62 Antibodies


Antigen Heat Shock Transcription Factor 4 (HSF4) Antibodies
Reactivity Human
(64), (12), (3), (1)
Host Rabbit
(43), (25), (2)
Conjugate This HSF4 antibody is un-conjugated
(3), (3), (3), (3), (3), (3)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
(67), (47), (8), (7), (3), (3), (3), (2), (1), (1)
Supplier Log in to see

Product Details anti-HSF4 Antibody

Target Details HSF4 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GKGSFSPEGPRNAQQPEPGDPREIPDRGPLGLESGDRSPESLLPPMLLQPPQESVEPAGPLDVLGPSLQGREWTLMDLDMELSLMQPLVPERGEPELAVKGLNSPSP
Isotype IgG

Target Details HSF4

Product Details anti-HSF4 Antibody Application Details Handling Images back to top
Alternative Name HSF4 (HSF4 Antibody Abstract)
Background Gene Symbol: HSF4
Gene ID 3299
Research Area Chromatin Binding Proteins, Transcription Factors, Chromatin and Nuclear Signaling
Pathways MAPK Signaling

Application Details

Product Details anti-HSF4 Antibody Target Details HSF4 Handling Images back to top
Application Notes Western Blot 1:250 - 1:500, Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-HSF4 Antibody Target Details HSF4 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-HSF4 Antibody Target Details HSF4 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-HSF4 antibody (Heat Shock Transcription Factor 4) (ABIN5077389) Western Blot: HSF4 Antibody - Western blot analysis in human cell line RT-4, human c...
Immunofluorescence (IF) image for anti-HSF4 antibody (Heat Shock Transcription Factor 4) (ABIN5077389) Immunocytochemistry/Immunofluorescence: HSF4 Antibody - Staining of human cell line ...