You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human MAP3K4 antibody for Immunocytochemistry

Recommended MAP3K4 Antibody (supplied by: Log in to see )

Antigen
Mitogen-Activated Protein Kinase Kinase Kinase 4 (MAP3K4) Antibodies
  • D17Rp17
  • D17Rp17e
  • MAPKKK4
  • Mek4b
  • Mekk4
  • MEKK 4
  • MEKK4
  • mKIAA0213
  • MTK1
  • PRO0412
  • RP17
  • Rp17a
  • Tas
Reactivity
Human
78
30
23
Host
Rabbit
57
21
Clonality
Polyclonal
Conjugate
This MAP3K4 antibody is un-conjugated
5
4
4
3
3
3
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
49
46
34
12
11
4
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Catalog No. ABIN4333541
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.0009965408 ABIN3060628 ICC IF WB Rabbit Log in to see Polyclonal

Similar anti-MAP3K4 Antibodies

Application / Reactivity Human
ELISA 46 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (IF) 2 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies
Immunohistochemistry (IHC) 35 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 13 Antibodies
Immunoprecipitation (IP) 4 Antibodies
Proximity Ligation Assay (PLA) 1 Antibodies
Western Blotting (WB) 49 Antibodies

General

Antigen Mitogen-Activated Protein Kinase Kinase Kinase 4 (MAP3K4) Antibodies
Reactivity Human
(78), (30), (23)
Host Rabbit
(57), (21)
Clonality
Polyclonal
Conjugate This MAP3K4 antibody is un-conjugated
(5), (4), (4), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(49), (46), (34), (12), (11), (4), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-MAP3K4 Antibody

Target Details MAP3K4 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KDREQRGQENTSGFWLNRSNELIWLELQAWHAGRTINDQDFFLYTARQAIPDIINEILTFKVDYGSFAFVRDRAGFNGTSVEGQCKATPGTKIVGYSTHHEHLQRQRVSFEQVKRIMELLEYIEALYPSLQ
Isotype IgG

Target Details MAP3K4

Product Details anti-MAP3K4 Antibody Application Details Handling Images back to top
Antigen
Alternative Name MEKK4 (MAP3K4 Antibody Abstract)
Background Gene Symbol: MAP3K4
Pathways MAPK Signaling

Application Details

Product Details anti-MAP3K4 Antibody Target Details MAP3K4 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-MAP3K4 Antibody Target Details MAP3K4 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.