anti-Human KAT2B antibody for Immunofluorescence

Recommended KAT2B Antibody (supplied by: Log in to see )

Antigen
K(lysine) Acetyltransferase 2B (KAT2B) Antibodies
  • PCAF
  • pcaf
  • si:ch211-1j13.2
  • zgc:161980
  • gb:dq017634
  • im:7156024
  • CAF
  • P
  • P/CAF
  • A930006P13Rik
  • AI461839
  • AW536563
  • Pcaf
  • p/CAF
  • K(lysine) acetyltransferase 2B
  • K(lysine) acetyltransferase 2A
  • p300/CBP-associated factor
  • KAT2B
  • kat2b
  • kat2a
  • Kat2b
  • Pcaf
Reactivity
Human
106
46
32
9
7
5
3
3
3
2
2
2
1
Host
Rabbit
76
31
Clonality
Polyclonal
Conjugate
This KAT2B antibody is un-conjugated
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF)
81
42
16
13
10
5
4
4
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5078666
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.149115 ABIN563838 IF ELISA WB Mouse IgG2b kappa AA 353-452, partial Log in to see 2B4
12.149115 ABIN522308 IF ELISA WB Mouse IgG2a kappa AA 353-452, partial Log in to see 5E5
12.149115 ABIN522306 IF ELISA WB Mouse IgG2a kappa AA 353-452, partial Log in to see 5E11
1 ABIN393975 IF WB Mouse IgG2a kappa AA 353-452 Log in to see 5E11
1 ABIN446938 ICC IF IHC (p) IHC WB Rabbit Log in to see Polyclonal

General

Antigen K(lysine) Acetyltransferase 2B (KAT2B) Antibodies
Reactivity Human
(106), (46), (32), (9), (7), (5), (3), (3), (3), (2), (2), (2), (1)
Host Rabbit
(76), (31)
Clonality
Polyclonal
Conjugate This KAT2B antibody is un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(81), (42), (16), (13), (10), (5), (4), (4), (1), (1), (1)
Supplier Log in to see

Product Details anti-KAT2B Antibody

Target Details KAT2B Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENY
Isotype IgG

Target Details KAT2B

Product Details anti-KAT2B Antibody Application Details Handling Images back to top
Antigen
Alternative Name PCAF (KAT2B Antibody Abstract)
Background Gene Symbol: KAT2B
Gene ID 8850
Pathways p53 Signaling, Regulation of Carbohydrate Metabolic Process

Application Details

Product Details anti-KAT2B Antibody Target Details KAT2B Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-KAT2B Antibody Target Details KAT2B Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-KAT2B Antibody Target Details KAT2B Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-K(lysine) Acetyltransferase 2B (KAT2B) antibody (ABIN5078666) Immunocytochemistry/Immunofluorescence: PCAF Antibody - Staining of human cell line ...