You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human p300 antibody for Immunocytochemistry

Recommended p300 Antibody (supplied by: Log in to see )

Antigen
E1A Binding Protein P300 (EP300) Antibodies
  • KAT3B
  • RSTS2
  • p300
  • A430090G16
  • A730011L11
  • p300 HAT
  • E1A binding protein p300
  • E1A-associated protein p300
  • EP300
  • ep300
  • Ep300
Reactivity
Human
272
128
116
39
37
15
3
3
3
3
3
Host
Rabbit
165
114
Clonality
Polyclonal
Conjugate
This p300 antibody is un-conjugated
12
12
10
8
6
6
4
4
4
4
4
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
193
101
82
72
57
53
51
46
28
10
5
2
2
2
2
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4328394
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN152048 ChIP ICC IF IP WB Mouse IgG1 kappa AA 1572-2371, AA 2107-2283 Log in to see RW109 4
1 ABIN151948 FACS ICC IF IP WB Mouse IgG1 kappa AA 1572-2371 Log in to see RW128 5
1 ABIN152047 ChIP EM FACS ICC IF IP in vitro WB Mouse IgG1 kappa AA 1572-2371, AA 1921-2023 Log in to see RW105 8
1 ABIN2668569 ChIPSeq ChIP ICC IF IP WB Mouse IgG1 Log in to see NM11 3
1 ABIN152981 ChIP ICC IF IHC IHC (p) IP WB Rabbit AA 1000-1050 Log in to see Polyclonal 4
1 ABIN1722721 ICC IF IP WB Mouse IgG1 kappa AA 1572-2371 Log in to see RW128
1 ABIN4328401 ChIP ICC IF IP WB PE Mouse IgG1 kappa AA 1572-2371, AA 1921-2023 Log in to see RW105
1 ABIN930935 DB ICC Mouse IgG1 Log in to see EP300G12
1 ABIN407350 ICC IF WB Biotin Mouse IgG1 kappa AA 1572-2371, AA 1921-2023 Log in to see RW105
1 ABIN407352 ICC IF WB DyLight 488 Mouse IgG1 kappa AA 1572-2371, AA 1921-2023 Log in to see RW105
1 ABIN4328393 ICC IF IHC IHC (p) Rabbit IgG Log in to see Polyclonal
1 ABIN4328397 ICC IF WB DyLight 405 Mouse IgG1 kappa AA 1572-2371, AA 1921-2023 Log in to see RW105
1 ABIN4328399 ICC IF WB DyLight 350 Mouse IgG1 kappa AA 1572-2371, AA 1921-2023 Log in to see RW105
1 ABIN4328403 ChIP ICC IF IP WB PerCP Mouse IgG1 kappa AA 1572-2371, AA 1921-2023 Log in to see RW105
1 ABIN4328407 ICC IF WB DyLight 755 Mouse IgG1 kappa AA 1572-2371, AA 1921-2023 Log in to see RW105
1 ABIN4328418 ICC IF WB Alexa Fluor 647 Mouse IgG1 kappa AA 1572-2371, AA 1921-2023 Log in to see RW105
1 ABIN4328389 ICC IF WB DyLight 550 Mouse IgG1 kappa AA 1572-2371, AA 1921-2023 Log in to see RW105
1 ABIN4328392 ICC IF WB DyLight 650 Mouse IgG1 kappa AA 1572-2371, AA 1921-2023 Log in to see RW105
1 ABIN4328409 ICC IF WB DyLight 680 Mouse IgG1 kappa AA 1572-2371, AA 1921-2023 Log in to see RW105
1 ABIN4328416 ICC IF WB Alexa Fluor 405 Mouse IgG1 kappa AA 1572-2371, AA 1921-2023 Log in to see RW105

Top referenced anti-p300 antibody for Immunocytochemistry

Similar anti-p300 Antibodies

Application / Reactivity Human
ChIP DNA-Sequencing (ChIPSeq) 2 Antibodies
Chromatin Immunoprecipitation (ChIP) 10 Antibodies
Dot Blot (DB) 57 Antibodies
Electron Microscopy (EM) 1 Antibodies
Electrophoretic Mobility-Shift Assay (EMSA) 1 Antibodies
ELISA 99 Antibodies
Enzyme Immunoassay (EIA) 5 Antibodies
Flow Cytometry (FACS) 2 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 50 Antibodies
Immunofluorescence (IF) 81 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 28 Antibodies
Immunohistochemistry (IHC) 70 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 46 Antibodies
Immunoprecipitation (IP) 49 Antibodies
In vitro Assay (in vitro) 1 Antibodies
Proximity Ligation Assay (PLA) 2 Antibodies

General

Antigen E1A Binding Protein P300 (EP300) Antibodies
Reactivity Human
(272), (128), (116), (39), (37), (15), (3), (3), (3), (3), (3)
Host Rabbit
(165), (114)
Clonality
Polyclonal
Conjugate This p300 antibody is un-conjugated
(12), (12), (10), (8), (6), (6), (4), (4), (4), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(193), (101), (82), (72), (57), (53), (51), (46), (28), (10), (5), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-p300 Antibody

Target Details p300 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQ
Isotype IgG

Target Details p300

Product Details anti-p300 Antibody Application Details Handling Images back to top
Antigen
Alternative Name KAT3B/p300 (EP300 Antibody Abstract)
Background Gene Symbol: EP300
Gene ID 2033
Pathways p53 Signaling, Notch Signaling, Interferon-gamma Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Regulation of Lipid Metabolism by PPARalpha, Regulation of Muscle Cell Differentiation

Application Details

Product Details anti-p300 Antibody Target Details p300 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-p300 Antibody Target Details p300 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-p300 Antibody Target Details p300 Application Details Handling back to top
Supplier Images
Immunocytochemistry (ICC) image for anti-p300 antibody (E1A Binding Protein P300) (ABIN4328394) Immunocytochemistry: KAT3B/p300 Antibody [NBP1-87694] - Staining of human cell line U...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-p300 antibody (E1A Binding Protein P300) (ABIN4328394) Immunohistochemistry-Paraffin: KAT3B/p300 Antibody [NBP1-87694] - Staining of human c...