You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human RRM2B antibody for Immunocytochemistry

Recommended RRM2B Antibody (supplied by: Log in to see )

Ribonucleotide Reductase M2 B (TP53 Inducible) (RRM2B) Antibodies
  • P53R2
  • p53r2
  • p53R2
  • RRM2B
This RRM2B antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4343020
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.0009990641 ABIN4343019 ELISA ICC IF IHC IHC (p) WB Rabbit Log in to see Polyclonal
0.0009990641 ABIN3047365 ICC IF WB Rabbit Log in to see Polyclonal

Similar anti-RRM2B Antibodies

Application / Reactivity Human
ELISA 41 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Immunocytochemistry (ICC) 3 Antibodies
Immunofluorescence (IF) 9 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies
Immunohistochemistry (IHC) 19 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 14 Antibodies
Immunoprecipitation (IP) 4 Antibodies
Western Blotting (WB) 68 Antibodies


Antigen Ribonucleotide Reductase M2 B (TP53 Inducible) (RRM2B) Antibodies
Reactivity Human
(87), (39), (36), (2), (1)
Host Rabbit
(82), (5)
Conjugate This RRM2B antibody is un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(68), (41), (18), (13), (11), (8), (4), (2), (2)
Supplier Log in to see

Product Details anti-RRM2B Antibody

Target Details RRM2B Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFV
Isotype IgG

Target Details RRM2B

Product Details anti-RRM2B Antibody Application Details Handling Images back to top
Alternative Name p53R2 (RRM2B Antibody Abstract)
Background Gene Symbol: RRM2B
UniProt Q7LG56
Research Area DNA/RNA, Transcription Factors, Cancer
Pathways p53 Signaling

Application Details

Product Details anti-RRM2B Antibody Target Details RRM2B Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-RRM2B Antibody Target Details RRM2B Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-RRM2B Antibody Target Details RRM2B Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-RRM2B antibody (Ribonucleotide Reductase M2 B (TP53 Inducible)) (ABIN4343020) Immunohistochemistry-Paraffin: p53R2 Antibody [NBP1-87368] - Immunohistochemical stai...
Immunofluorescence (IF) image for anti-RRM2B antibody (Ribonucleotide Reductase M2 B (TP53 Inducible)) (ABIN4343020) Immunocytochemistry/Immunofluorescence: p53R2 Antibody [NBP1-87368] - Staining of hum...