You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) MAPKAP1 antibody for Immunohistochemistry

Recommended MAPKAP1 Antibody (supplied by: Log in to see )

Antigen
Mitogen-Activated Protein Kinase Associated Protein 1 (MAPKAP1) Antibodies
  • CG10105
  • Dmel\\CG10105
  • dSin1
  • sin1
  • MAPKAP1
  • im:7143088
  • si:ch73-242f23.1
  • mip1
  • sin1b
  • sin1g
  • MGC53034
  • JC310
  • MIP1
  • SIN1
  • SIN1b
  • SIN1g
  • AI591529
  • D230039K05Rik
  • Sin1
  • SAPK-interacting protein 1
  • mitogen-activated protein kinase associated protein 1
  • Sin1
  • MAPKAP1
  • mapkap1
  • Mapkap1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
85
46
40
12
10
5
3
3
3
2
1
1
1
Host
Rabbit
87
Clonality
Polyclonal
Conjugate
This MAPKAP1 antibody is un-conjugated
2
2
2
2
2
2
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
77
35
34
17
13
4
4
2
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4353814
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.583081 ABIN2448675 IHC ELISA WB Rabbit N-Term Log in to see Polyclonal
8.583081 ABIN1031450 IHC ELISA WB Rabbit N-Term Log in to see Polyclonal
8.583081 ABIN1030995 IHC ELISA WB Rabbit Middle Region Log in to see Polyclonal
8.583081 ABIN2448674 IHC ELISA WB Rabbit Log in to see Polyclonal
1 ABIN258134 ICC IF IHC IHC (p) IP PLA WB Rabbit IgG C-Term Log in to see Polyclonal 4
1 ABIN1002803 IHC ELISA WB Rabbit IgG Internal Region Log in to see Polyclonal 4
1 ABIN1002804 IHC ELISA WB Rabbit IgG N-Term Log in to see Polyclonal 4
1 ABIN1873635 IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN4353811 ELISA ICC IF IHC IHC (p) WB Rabbit N-Term Log in to see Polyclonal
1 ABIN4353812 ELISA IHC IHC (p) WB Rabbit Center Log in to see Polyclonal
1 ABIN1088841 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal
1 ABIN1088842 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal
1 ABIN1888099 IHC ELISA WB Rabbit N-Term Log in to see Polyclonal
1 ABIN1887685 IHC ELISA WB Rabbit Center Log in to see Polyclonal
1 ABIN2472006 IHC WB Rabbit AA 100-150 Log in to see Polyclonal
1 ABIN1584753 IHC ELISA WB Rabbit Log in to see Polyclonal
1 ABIN1584754 IHC ELISA WB Rabbit Log in to see Polyclonal
1 ABIN2975276 ICC IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2938571 ELISA IF/ICC IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN3048487 IHC WB Rabbit Log in to see Polyclonal

Top referenced anti-MAPKAP1 antibody for Immunohistochemistry

Similar anti-MAPKAP1 Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine) Human
ELISA 15 Antibodies 15 Antibodies 35 Antibodies
Immunocytochemistry (ICC) 3 Antibodies 4 Antibodies
Immunofluorescence (IF) 9 Antibodies 10 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies 1 Antibodies
Immunohistochemistry (IHC) 20 Antibodies 21 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 16 Antibodies 17 Antibodies
Immunoprecipitation (IP) 1 Antibodies 4 Antibodies
Proximity Ligation Assay (PLA) 1 Antibodies 2 Antibodies
Western Blotting (WB) 40 Antibodies 45 Antibodies

General

Antigen Mitogen-Activated Protein Kinase Associated Protein 1 (MAPKAP1) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(85), (46), (40), (12), (10), (5), (3), (3), (3), (2), (1), (1), (1)
Host Rabbit
(87)
Clonality
Polyclonal
Conjugate This MAPKAP1 antibody is un-conjugated
(2), (2), (2), (2), (2), (2), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(77), (35), (34), (17), (13), (4), (4), (2), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-MAPKAP1 Antibody

Target Details MAPKAP1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLFVRINAAHGFSLIQVDNTKVTMKE
Isotype IgG

Target Details MAPKAP1

Product Details anti-MAPKAP1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Sin1/MAPKAP1 (MAPKAP1 Antibody Abstract)
Background Gene Symbol: MAPKAP1
Gene ID 79109
Pathways PI3K-Akt Signaling, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway

Application Details

Product Details anti-MAPKAP1 Antibody Target Details MAPKAP1 Handling Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-MAPKAP1 Antibody Target Details MAPKAP1 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-MAPKAP1 Antibody Target Details MAPKAP1 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-MAPKAP1 antibody (Mitogen-Activated Protein Kinase Associated Protein 1) (ABIN4353814) Immunohistochemistry: Sin1/MAPKAP1 Antibody [NBP1-89569] - Staining of human tonsil s...
Western Blotting (WB) image for anti-MAPKAP1 antibody (Mitogen-Activated Protein Kinase Associated Protein 1) (ABIN4353814) Western Blot: Sin1/MAPKAP1 Antibody [NBP1-89569] - Lane 1: NIH-3T3 cell lysate (Mouse...
Immunofluorescence (IF) image for anti-MAPKAP1 antibody (Mitogen-Activated Protein Kinase Associated Protein 1) (ABIN4353814) Immunocytochemistry/Immunofluorescence: Sin1/MAPKAP1 Antibody [NBP1-89569] - Staining...