You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) PDK2 antibody for Immunocytochemistry

Recommended PDK2 Antibody (supplied by: Log in to see )

Antigen
Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2) Antibodies
  • 3j828
  • MGC52849
  • MGC132353
  • Pdk
  • zgc:56209
  • PDK2
  • PDHK2
  • PDKII
  • pyruvate dehydrogenase kinase, isozyme 4
  • pyruvate dehydrogenase kinase, isoenzyme 2
  • pyruvate dehydrogenase kinase, isozyme 2
  • pdk4
  • pdk2
  • PDK2
  • Pdk2
Reactivity
Human, Mouse (Murine)
125
62
33
5
3
1
Host
Rabbit
104
41
Clonality
Polyclonal
Conjugate
This PDK2 antibody is un-conjugated
9
9
8
7
7
7
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
123
85
61
28
18
11
4
3
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4344598
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1860173 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG AA 155-379 Log in to see Polyclonal
1 ABIN3032416 ICC IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal

Top referenced anti-PDK2 antibody for Immunocytochemistry

Similar anti-PDK2 Antibodies

Application / Reactivity Mouse (Murine) Human
ELISA 22 Antibodies 74 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies 3 Antibodies
Immunocytochemistry (ICC) 3 Antibodies 4 Antibodies
Immunofluorescence (IF) 1 Antibodies 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies 11 Antibodies
Immunohistochemistry (IHC) 10 Antibodies 61 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 11 Antibodies
Western Blotting (WB) 44 Antibodies
Flow Cytometry (FACS) 18 Antibodies
Immunochromatography (IC) 1 Antibodies

General

Antigen Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2) Antibodies
Reactivity Human, Mouse (Murine)
(125), (62), (33), (5), (3), (1)
Host Rabbit
(104), (41)
Clonality
Polyclonal
Conjugate This PDK2 antibody is un-conjugated
(9), (9), (8), (7), (7), (7), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(123), (85), (61), (28), (18), (11), (4), (3), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-PDK2 Antibody

Target Details PDK2 Application Details Handling References for anti-PDK2 Antibody (ABIN4344598) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KTSFTFLRQELPVRLANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGSTN
Isotype IgG

Target Details PDK2

Product Details anti-PDK2 Antibody Application Details Handling References for anti-PDK2 Antibody (ABIN4344598) Images back to top
Antigen
Alternative Name PDK2 (PDK2 Antibody Abstract)
Background Gene Symbol: PDK2
Gene ID 5164
Research Area Metabolism, Cancer
Pathways PI3K-Akt Signaling, RTK Signaling

Application Details

Product Details anti-PDK2 Antibody Target Details PDK2 Handling References for anti-PDK2 Antibody (ABIN4344598) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PDK2 Antibody Target Details PDK2 Application Details References for anti-PDK2 Antibody (ABIN4344598) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-PDK2 Antibody (ABIN4344598)

Product Details anti-PDK2 Antibody Target Details PDK2 Application Details Handling Images back to top
Product cited in:

Hou, Zhang, Han, Ge, Ma, Zhang, Moley, Schedl, Wang: "Differing roles of pyruvate dehydrogenase kinases during mouse oocyte maturation." in: Journal of cell science, Vol. 128, Issue 13, pp. 2319-29, 2015 (Sample species: Mouse (Murine)). Further details: Immunocytochemistry,Immunofluorescence

Images

Product Details anti-PDK2 Antibody Target Details PDK2 Application Details Handling References for anti-PDK2 Antibody (ABIN4344598) back to top
Supplier Images
Immunofluorescence (IF) image for anti-PDK2 antibody (Pyruvate Dehydrogenase Kinase, Isozyme 2) (ABIN4344598) Immunocytochemistry/Immunofluorescence: PDK2 Antibody [NBP1-87307] - Staining of huma...
Immunofluorescence (IF) image for anti-PDK2 antibody (Pyruvate Dehydrogenase Kinase, Isozyme 2) (ABIN4344598) Immunocytochemistry/Immunofluorescence: PDK2 Antibody [NBP1-87307] - Staining of huma...
Western Blotting (WB) image for anti-PDK2 antibody (Pyruvate Dehydrogenase Kinase, Isozyme 2) (ABIN4344598) Western Blot: PDK2 Antibody [NBP1-87307] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PDK2 antibody (Pyruvate Dehydrogenase Kinase, Isozyme 2) (ABIN4344598) Immunohistochemistry-Paraffin: PDK2 Antibody [NBP1-87307] - Staining of human heart m...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PDK2 antibody (Pyruvate Dehydrogenase Kinase, Isozyme 2) (ABIN4344598) Immunohistochemistry-Paraffin: PDK2 Antibody [NBP1-87307] - Staining of human pancrea...