You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rat (Rattus) PPP2R5D antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended PPP2R5D Antibody (supplied by: Log in to see )

Antigen
Protein Phosphatase 2, Regulatory Subunit B', delta (PPP2R5D) Antibodies
  • zgc:73160
  • zgc:77529
  • ppp2r5d
  • B'delta
  • TEG-271
  • Tex271
  • B56D
  • protein phosphatase 2, regulatory subunit B', delta
  • serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform-like
  • protein phosphatase 2, regulatory subunit B (B56), delta isoform
  • ppp2r5d
  • PPP2R5D
  • LOC100176996
  • Ppp2r5d
Reactivity
Human, Mouse (Murine), Rat (Rattus)
95
28
27
7
3
3
2
2
1
1
1
Host
Rabbit
61
17
17
Clonality
Polyclonal
Conjugate
This PPP2R5D antibody is un-conjugated
5
4
4
3
3
3
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
75
38
12
11
9
8
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4347121
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.203815 ABIN4347122 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN1412420 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN2963873 IHC (p) ELISA WB Rabbit IgG AA 544-593 Log in to see Polyclonal
1 ABIN1394527 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN1386646 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal

Similar anti-PPP2R5D Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine) Human
ELISA 7 Antibodies 7 Antibodies 38 Antibodies
Immunocytochemistry (ICC) 2 Antibodies 2 Antibodies 2 Antibodies
Immunofluorescence (IF) 2 Antibodies 2 Antibodies 3 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies 11 Antibodies
Immunohistochemistry (IHC) 2 Antibodies 2 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 6 Antibodies 6 Antibodies
Immunoprecipitation (IP) 1 Antibodies 1 Antibodies
Western Blotting (WB) 18 Antibodies 18 Antibodies

General

Antigen Protein Phosphatase 2, Regulatory Subunit B', delta (PPP2R5D) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(95), (28), (27), (7), (3), (3), (2), (2), (1), (1), (1)
Host Rabbit
(61), (17), (17)
Clonality
Polyclonal
Conjugate This PPP2R5D antibody is un-conjugated
(5), (4), (4), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(75), (38), (12), (11), (9), (8), (2), (1)
Supplier Log in to see

Product Details anti-PPP2R5D Antibody

Target Details PPP2R5D Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVY
Isotype IgG

Target Details PPP2R5D

Product Details anti-PPP2R5D Antibody Application Details Handling Images back to top
Antigen
Alternative Name PPP2R5D (PPP2R5D Antibody Abstract)
Background Gene Symbol: PPP2R5D
Gene ID 5528
Research Area Signaling
Pathways PI3K-Akt Signaling

Application Details

Product Details anti-PPP2R5D Antibody Target Details PPP2R5D Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PPP2R5D Antibody Target Details PPP2R5D Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-PPP2R5D Antibody Target Details PPP2R5D Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-PPP2R5D antibody (Protein Phosphatase 2, Regulatory Subunit B', delta) (ABIN4347121) Western Blot: PPP2R5D Antibody [NBP1-88959] - Lane 1: NIH-3T3 cell lysate (Mouse embr...
Immunofluorescence (IF) image for anti-PPP2R5D antibody (Protein Phosphatase 2, Regulatory Subunit B', delta) (ABIN4347121) Immunocytochemistry/Immunofluorescence: PPP2R5D Antibody [NBP1-88959] - Staining of h...
Western Blotting (WB) image for anti-PPP2R5D antibody (Protein Phosphatase 2, Regulatory Subunit B', delta) (ABIN4347121) Western Blot: PPP2R5D Antibody [NBP1-88959] - Lane 1: Marker [kDa] 230, 130, 95, 72, ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PPP2R5D antibody (Protein Phosphatase 2, Regulatory Subunit B', delta) (ABIN4347121) Immunohistochemistry-Paraffin: PPP2R5D Antibody [NBP1-88959] - Staining of human cere...