anti-Mouse (Murine) Integrin beta 3 antibody for Western Blotting

Recommended Integrin beta 3 Antibody (supplied by: Log in to see )

Antigen
Integrin beta 3 (ITGB3) Antibodies
  • CD61
  • GP3A
  • INGRB3
  • BDPLT16
  • BDPLT2
  • GPIIIa
  • GT
  • INTB3
  • integrin
  • GPIIIA
  • integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61)
  • integrin beta 3
  • integrin, beta 3
  • ITGB3
  • Itgb3
Epitope
AA 753-786, C-Term
49
42
33
24
19
19
17
15
9
8
6
4
4
4
3
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
602
248
202
28
27
25
24
19
16
13
6
5
4
4
4
3
2
2
2
2
2
2
1
1
1
1
Host
Rabbit
378
237
52
29
28
4
1
Clonality
Polyclonal
Conjugate
This Integrin beta 3 antibody is un-conjugated
78
54
27
22
18
14
13
13
13
10
9
8
8
8
7
7
7
7
6
6
6
5
2
2
2
2
2
2
2
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
440
282
167
136
111
91
81
76
65
27
14
13
13
8
6
5
5
4
2
2
2
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN3043262
$ 240.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
3.2182703 ABIN739029 ELISA IF (cc) IF (p) IHC (p) WB Rabbit IgG AA 27-77 Log in to see Polyclonal 3
3.2182703 ABIN2704620 IHC WB Rabbit C-Term, pTyr773 Log in to see Polyclonal
3.2182703 ABIN2704622 IHC WB Rabbit C-Term Log in to see Polyclonal
3.2182703 ABIN2704621 IC IF IP IHC WB Rabbit C-Term Log in to see Polyclonal
3.2182703 ABIN1449278 FACS IP WB Rat IgG2a Log in to see 1-55-4 2
3.2182703 ABIN1532906 IHC ELISA WB Rabbit IgG AA 739-788 Log in to see Polyclonal
3.2182703 ABIN1532905 IHC ELISA WB Rabbit IgG AA 731-780 Log in to see Polyclonal
3.2182703 ABIN1531874 IHC ELISA WB Rabbit IgG AA 739-788, pTyr773 Log in to see Polyclonal
3.2182703 ABIN1531875 ELISA WB Rabbit IgG AA 739-788, pTyr785 Log in to see Polyclonal
3.2182703 ABIN3182412 ELISA WB Rabbit IgG pTyr785 Log in to see Polyclonal
3.2182703 ABIN3185204 ELISA IHC WB Rabbit IgG Ser63 Log in to see Polyclonal
3.2182703 ABIN3185205 ELISA IHC WB Rabbit IgG Ser632 Log in to see Polyclonal
3.2182703 ABIN2801428 WB Rabbit C-Term Log in to see Polyclonal
3.2182703 ABIN257360 WB Rabbit pTyr785 Log in to see Polyclonal
3.2182703 ABIN1870281 WB Rabbit IgG pTyr785 Log in to see Polyclonal
3.2182703 ABIN1870283 IHC WB Rabbit IgG pTyr773 Log in to see Polyclonal
3.2182703 ABIN408417 IHC (p) IHC WB Rabbit pTyr773 Log in to see Polyclonal
3.2182703 ABIN1875445 IHC WB Rabbit IgG Log in to see Polyclonal
3.2182703 ABIN449350 IHC (p) IHC WB Rabbit Log in to see Polyclonal
3.2182703 ABIN1859506 ICC IHC IP WB Rabbit IgG AA 135-377 Log in to see Polyclonal

General

Antigen Integrin beta 3 (ITGB3) Antibodies
Epitope AA 753-786, C-Term
(49), (42), (33), (24), (19), (19), (17), (15), (9), (8), (6), (4), (4), (4), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(602), (248), (202), (28), (27), (25), (24), (19), (16), (13), (6), (5), (4), (4), (4), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Host Rabbit
(378), (237), (52), (29), (28), (4), (1)
Clonality
Polyclonal
Conjugate This Integrin beta 3 antibody is un-conjugated
(78), (54), (27), (22), (18), (14), (13), (13), (13), (10), (9), (8), (8), (8), (7), (7), (7), (7), (6), (6), (6), (5), (2), (2), (2), (2), (2), (2), (2)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(440), (282), (167), (136), (111), (91), (81), (76), (65), (27), (14), (13), (13), (8), (6), (5), (5), (4), (2), (2), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-Integrin beta 3 Antibody

Target Details Integrin beta 3 Application Details Handling Images
Purpose Rabbit IgG polyclonal antibody for Integrin beta-3(ITGB3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Sequence FAKFEEERAR AKWDTANNPL YKEATSTFTN ITYR
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Integrin beta-3(ITGB3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61)
Protein Name: Integrin beta-3
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Integrin beta 3 (753-786aa FAKFEEERARAKWDTANNPLYKEATSTFTNITYR), identical to the related mouse and rat sequences
Isotype IgG

Target Details Integrin beta 3

Product Details anti-Integrin beta 3 Antibody Application Details Handling Images back to top
Antigen
Alternative Name ITGB3 (ITGB3 Antibody Abstract)
Background ITGB3 (INTEGRIN, BETA-3), also called GP3A, GPIIIa, CD61, is a protein that in humans is encoded by the ITGB3 gene. It is a cluster of differentiation found on thrombocytes. This gene is mapped to 17q21.32. And the GP3A gene has 14 exons. The 3-prime exon is larger than 1,700 nucleotides and contains the 3-prime untranslated region. The ITGB3 complex belongs to the integrin class of cell adhesion molecule receptors that share a common heterodimeric structure with alpha and beta subunits. Additionally, the ITGB3 complex mediates platelet aggregation by acting as a receptor for fibrinogen. Although the ITGB3 is expressed on the cell surface at normal levels and is capable of function following extracellular stimulation, it could not be activated via the 'inside-out' signaling pathways.

Synonyms: BDPLT2 antibody|CD 61 antibody|CD61 antibody|CD61 antigen antibody|GP3A antibody|GPIIIa antibody|GT antibody|HPA 1 antibody|HPA 4 antibody|Integrin beta 3 (platelet glycoprotein IIIa antigen CD61) antibody|Integrin beta chain beta 3 antibody|Integrin beta-3 antibody|ITB3_HUMAN antibody|ITG B3 antibody|ITGB 3 antibody|ITGB3 antibody|NAIT antibody| Platelet fibrinogen receptor beta subunit antibody|Platelet glycoprotein IIIa antibody|platelet glycoprotein IIIa precursor antibody|Platelet membrane glycoprotein IIIa antibody|PTP antibody
Gene ID 3690
UniProt P05106
Pathways Regulation of G-Protein Coupled Receptor Protein Signaling, Signaling Events mediated by VEGFR1 and VEGFR2, Smooth Muscle Cell Migration, Integrin Complex

Application Details

Product Details anti-Integrin beta 3 Antibody Target Details Integrin beta 3 Handling Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Comment

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions For Research Use only

Handling

Product Details anti-Integrin beta 3 Antibody Target Details Integrin beta 3 Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Images

Product Details anti-Integrin beta 3 Antibody Target Details Integrin beta 3 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Integrin beta 3 (ITGB3) (AA 753-786), (C-Term) antibody (ABIN3043262) anti-Integrin beta 3 (ITGB3) (AA 753-786), (C-Term) antibody
Immunohistochemistry (IHC) image for anti-Integrin beta 3 (ITGB3) (AA 753-786), (C-Term) antibody (ABIN3043262) Anti- Integrin beta 3 Picoband antibody, IHC(P) IHC(P): Human Intestinal Cancer Tissue