anti-Human EPH Receptor B1 antibody for Immunofluorescence

Recommended EPH Receptor B1 Antibody (supplied by: Log in to see )

EPH Receptor B1 (EPHB1) Antibodies
  • Xek
  • MGC89790
  • EPHB1
  • Ephb2
  • Erk
  • elk
  • ELK
  • EPHT2
  • Hek6
  • NET
  • 9330129L11
  • AW488255
  • C130099E04Rik
  • Cek6
  • ENSMUSG00000074119
  • Elk
  • Elkh
  • Net
  • CEK6
  • EK6
  • ephb1-a
  • xek
  • EPH receptor B1
  • Eph receptor B1
  • EPHB1
  • ephb1
  • Ephb1
This EPH Receptor B1 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5076557
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN449958 ELISA ICC IF IHC IHC (p) WB Mouse IgG1 Log in to see 5F10A4
1 ABIN498198 IF IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN5577405 ELISA IF IHC (p) WB Rabbit Log in to see Polyclonal


Antigen EPH Receptor B1 (EPHB1) Antibodies
Reactivity Human
(119), (81), (73), (3)
Host Rabbit
(106), (15), (7), (3)
Conjugate This EPH Receptor B1 antibody is un-conjugated
(5), (5), (5), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(79), (40), (36), (22), (21), (6), (4), (3), (3), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-EPH Receptor B1 Antibody

Target Details EPH Receptor B1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNE
Isotype IgG

Target Details EPH Receptor B1

Product Details anti-EPH Receptor B1 Antibody Application Details Handling Images back to top
Alternative Name EphB1 (EPHB1 Antibody Abstract)
Background Gene Symbol: EPHB1
Gene ID 2047
Pathways RTK Signaling

Application Details

Product Details anti-EPH Receptor B1 Antibody Target Details EPH Receptor B1 Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-EPH Receptor B1 Antibody Target Details EPH Receptor B1 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-EPH Receptor B1 Antibody Target Details EPH Receptor B1 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-EPH Receptor B1 (EPHB1) antibody (ABIN5076557) Immunohistochemistry-Paraffin: EphB1 Antibody - Immunohistochemical staining of huma...
Immunofluorescence (IF) image for anti-EPH Receptor B1 (EPHB1) antibody (ABIN5076557) Immunocytochemistry/Immunofluorescence: EphB1 Antibody - Staining of human cell line...