anti-Human Neuregulin 1 antibody for Immunohistochemistry

Recommended Neuregulin 1 Antibody (supplied by: Log in to see )

Antigen
Neuregulin 1 (NRG1) Antibodies
  • NRG1
  • wu:fm70e01
  • DKFZp459A1838
  • HPRG
  • HRGP
  • THPH11
  • HRG1
  • ARIA
  • GGF
  • GGF2
  • HGL
  • HRG
  • HRGA
  • MST131
  • NDF
  • SMDF
  • 6030402G23Rik
  • D230005F13Rik
  • GGFII
  • HRGalpha
  • Hgl
  • pro-neuregulin-1
  • NRG-1
  • heregulin
  • nrg1-A
  • neuregulin 1
  • histidine-rich glycoprotein
  • NRG1
  • nrg1
  • Nrg1
  • HRG
  • Hrg
Reactivity
Human
207
79
77
3
3
2
1
1
1
1
1
Host
Rabbit
198
42
Clonality
Polyclonal
Conjugate
This Neuregulin 1 antibody is un-conjugated
19
12
5
4
3
3
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
198
113
67
39
19
16
15
11
8
5
5
5
5
4
3
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4338706
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
9.804209 ABIN3031974 FACS IHC ELISA WB Rabbit Ig Fraction AA 198-229 Log in to see Polyclonal
9.804209 ABIN2434770 IHC ELISA Rabbit IgG Log in to see Polyclonal
9.804209 ABIN2433143 IHC ELISA Rabbit IgG Log in to see Polyclonal
9.804209 ABIN1848606 IHC ELISA WB Rabbit N-Term Log in to see Polyclonal
1 ABIN3021079 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN216925 IHC WB Rabbit Log in to see Polyclonal
1 ABIN1175117 ICC IHC IP WB Rabbit IgG AA 20-242 Log in to see Polyclonal
1 ABIN3185838 ELISA IF IHC WB Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN2313665 IC IHC WB Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN2467234 IHC ELISA WB Rabbit IgG Isoform 10 Log in to see Polyclonal
1 ABIN2584429 ELISA IHC WB Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN1918550 FACS IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG Log in to see Polyclonal
1 ABIN1918552 FACS IHC ELISA WB FITC Rabbit IgG Log in to see Polyclonal
1 ABIN1918554 FACS IHC ELISA WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN1918551 FACS IHC ELISA WB APC Rabbit IgG Log in to see Polyclonal
1 ABIN1918553 FACS IHC ELISA WB PE Rabbit IgG Log in to see Polyclonal
1 ABIN2313637 FACS IHC ELISA WB Rabbit IgG Center, Internal Region Log in to see Polyclonal
1 ABIN2313653 IHC ELISA WB HRP Rabbit IgG Center, Internal Region Log in to see Polyclonal
1 ABIN2313656 FACS IHC ELISA WB PE Rabbit IgG Center, Internal Region Log in to see Polyclonal
1 ABIN2313643 FACS IHC ELISA WB APC Rabbit IgG Center, Internal Region Log in to see Polyclonal

Similar anti-Neuregulin 1 Antibodies

Application / Reactivity Human
Blocking Reagent (BR) 3 Antibodies
Cell Culture (CC) 1 Antibodies
ELISA 91 Antibodies
Enzyme Immunoassay (EIA) 4 Antibodies
Flow Cytometry (FACS) 19 Antibodies
Immunochromatography (IC) 2 Antibodies
Immunocytochemistry (ICC) 7 Antibodies
Immunofluorescence (IF) 5 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 16 Antibodies
Immunohistochemistry (IHC) 54 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 5 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 40 Antibodies
Immunoprecipitation (IP) 9 Antibodies
Neutralization (Neut) 8 Antibodies
Western Blotting (WB) 166 Antibodies

General

Antigen Neuregulin 1 (NRG1) Antibodies
Reactivity Human
(207), (79), (77), (3), (3), (2), (1), (1), (1), (1), (1)
Host Rabbit
(198), (42)
Clonality
Polyclonal
Conjugate This Neuregulin 1 antibody is un-conjugated
(19), (12), (5), (4), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(198), (113), (67), (39), (19), (16), (15), (11), (8), (5), (5), (5), (5), (4), (3), (1)
Supplier Log in to see

Product Details anti-Neuregulin 1 Antibody

Target Details Neuregulin 1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KWFKNGNELNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGNDSASANITIVESNATSTSTTGTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLC
Isotype IgG

Target Details Neuregulin 1

Product Details anti-Neuregulin 1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Neuregulin-1/NRG1 (NRG1 Antibody Abstract)
Background Gene Symbol: NRG1
Gene ID 3084
Pathways RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Muscle Cell Differentiation

Application Details

Product Details anti-Neuregulin 1 Antibody Target Details Neuregulin 1 Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000Immunohistochemistry retrieval recommended: HIER pH 6
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Neuregulin 1 Antibody Target Details Neuregulin 1 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-Neuregulin 1 Antibody Target Details Neuregulin 1 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Neuregulin 1 antibody (NRG1) (ABIN4338706) Immunohistochemistry: Neuregulin-1/NRG1 Antibody [NBP1-81834] - Immunohistochemical s...