anti-Human PAK4 antibody for Immunocytochemistry

Recommended PAK4 Antibody (supplied by: Log in to see )

Antigen
P21-Activated Kinase 4 (PAK4) Antibodies
  • 5730488L07Rik
  • AW555722
  • mKIAA1142
  • p21 protein (Cdc42/Rac)-activated kinase 4
  • p21-activated kinase 4
  • PAK4
  • LOC100336246
  • Pak4
Reactivity
Human
184
89
73
19
8
7
6
5
3
2
2
2
2
1
1
Host
Rabbit
155
29
2
Clonality
Polyclonal
Conjugate
This PAK4 antibody is un-conjugated
12
11
10
6
6
5
3
3
3
3
3
3
3
3
2
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
139
66
45
34
23
23
12
7
6
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN5078627
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN5078628 ICC IF WB Rabbit IgG Log in to see Polyclonal
1 ABIN3186315 ELISA ICC WB Rabbit IgG Tyr536 Log in to see Polyclonal
1 ABIN2626537 ICC IF WB Rabbit pSer474 Log in to see Polyclonal
1 ABIN2959856 ICC IF ELISA WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN5567207 FACS ICC IF IHC PE Rabbit Log in to see Polyclonal
1 ABIN5567204 FACS ICC IF IHC APC Rabbit Log in to see Polyclonal
1 ABIN5567205 FACS ICC IF IHC FITC Rabbit Log in to see Polyclonal

Similar anti-PAK4 Antibodies

Application / Reactivity Human
ELISA 66 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Flow Cytometry (FACS) 22 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 8 Antibodies
Immunofluorescence (IF) 13 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 34 Antibodies
Immunohistochemistry (IHC) 44 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 23 Antibodies
Immunoprecipitation (IP) 6 Antibodies
Radioimmunoassay (RIA) 1 Antibodies
Western Blotting (WB) 138 Antibodies

General

Antigen P21-Activated Kinase 4 (PAK4) Antibodies
Reactivity Human
(184), (89), (73), (19), (8), (7), (6), (5), (3), (2), (2), (2), (2), (1), (1)
Host Rabbit
(155), (29), (2)
Clonality
Polyclonal
Conjugate This PAK4 antibody is un-conjugated
(12), (11), (10), (6), (6), (5), (3), (3), (3), (3), (3), (3), (3), (3), (2), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
(139), (66), (45), (34), (23), (23), (12), (7), (6), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-PAK4 Antibody

Target Details PAK4 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RQWQSLIEESARRPKPLVDPACITSIQPGAPKTIVRGSKGAKDGALTLLLDEFENM
Isotype IgG

Target Details PAK4

Product Details anti-PAK4 Antibody Application Details Handling Images back to top
Antigen
Alternative Name PAK4 (PAK4 Antibody Abstract)
Background Gene Symbol: PAK4
Gene ID 10298
Research Area Kinases/Phosphatases, Cell Cycle, Microfilaments, Cytoskeleton, Apoptosis/Necrosis, Cancer
Pathways RTK Signaling

Application Details

Product Details anti-PAK4 Antibody Target Details PAK4 Handling Images back to top
Application Notes Western Blot 1:250 - 1:500, Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PAK4 Antibody Target Details PAK4 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-PAK4 Antibody Target Details PAK4 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-PAK4 antibody (P21-Activated Kinase 4) (ABIN5078627) Western Blot: PAK4 Antibody - Western blot analysis in human cell line RT-4 and huma...
Immunofluorescence (IF) image for anti-PAK4 antibody (P21-Activated Kinase 4) (ABIN5078627) Immunocytochemistry/Immunofluorescence: PAK4 Antibody - Staining of human cell line ...