You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human CD83 antibody for Immunohistochemistry

Recommended CD83 Antibody (supplied by: Log in to see )

CD83 Antibodies
  • BL11
  • HB15
  • CD83 molecule
  • CD83 antigen
  • Cd83
  • CD83
This CD83 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4296241
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1450905 IHC ELISA WB Rabbit IgG Internal Region Log in to see Polyclonal 1
1 ABIN2659323 FACS IF IP IHC PE-Cy7 Mouse IgG1 kappa Log in to see HB15e 7
1 ABIN3183788 ELISA IHC WB Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN1871655 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN3022766 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2659324 FACS IF IP IHC PE-Cy7 Mouse IgG1 kappa Log in to see HB15e 7
1 ABIN1867132 ICC IHC IP WB Rabbit IgG AA 24-205 Log in to see Polyclonal
1 ABIN251086 CyTOF FACS Func ICC IF IHC Mouse IgG1 Log in to see UCH-B1
1 ABIN204043 FACS IP IHC Mouse IgG1 Log in to see
1 ABIN211881 FACS IF IHC Mouse IgG2b, kappa Log in to see HB15a
1 ABIN4262278 CyTOF FACS IHC IHC (fro) Mouse IgG1 Log in to see MM0179-4B34
1 ABIN2880053 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN4262284 FACS IHC IHC (fro) DyLight 405 Mouse IgG1 Log in to see MM0179-4B34
1 ABIN4262281 FACS IHC IHC (fro) DyLight 350 Mouse IgG1 Log in to see MM0179-4B34
1 ABIN4262289 FACS IHC IHC (fro) PerCP Mouse IgG1 Log in to see MM0179-4B34
1 ABIN4262298 FACS IHC IHC (fro) DyLight 488 Mouse IgG1 Log in to see MM0179-4B34
1 ABIN4262295 FACS IHC IHC (fro) DyLight 755 Mouse IgG1 Log in to see MM0179-4B34
1 ABIN4262304 FACS IHC IHC (fro) DyLight 680 Mouse IgG1 Log in to see MM0179-4B34
1 ABIN4262314 FACS IHC IHC (fro) Alexa Fluor 488 Mouse IgG1 Log in to see MM0179-4B34
1 ABIN4262323 FACS IHC IHC (p) DyLight 650 Mouse IgG1 Log in to see UCH-B1

Top referenced anti-CD83 antibody for Immunohistochemistry

Similar anti-CD83 Antibodies

Application / Reactivity Human
Biochemical Assay (BCA) 2 Antibodies
Cell Culture (CC) 1 Antibodies
Cytometry by Time of Flight (CyTOF) 2 Antibodies
ELISA 21 Antibodies
ELISA (Detection) 1 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Flow Cytometry (FACS) 150 Antibodies
Functional Studies (Func) 1 Antibodies
Immunocytochemistry (ICC) 5 Antibodies
Immunofluorescence (IF) 19 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 4 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 56 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 16 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 27 Antibodies
Immunoprecipitation (IP) 8 Antibodies
Western Blotting (WB) 49 Antibodies


Antigen CD83 Antibodies
Reactivity Human
(218), (93), (40), (20), (15), (7), (5), (5), (5), (1), (1), (1)
Host Rabbit
(149), (69), (53), (8)
Conjugate This CD83 antibody is un-conjugated
(31), (25), (16), (13), (12), (6), (6), (5), (5), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(186), (57), (55), (29), (28), (26), (20), (16), (10), (6), (4), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-CD83 Antibody

Target Details CD83 Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: PNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEET

Target Details CD83

Product Details anti-CD83 Antibody Application Details Handling Images back to top
Alternative Name CD83 (CD83 Antibody Abstract)
Background Gene Symbol: CD83
Gene ID 9308
UniProt Q01151
Research Area Adaptive Immunity, Immunology, Surface Receptors of Immune Cells, CD Antigens
Pathways TCR Signaling

Application Details

Product Details anti-CD83 Antibody Target Details CD83 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-CD83 Antibody Target Details CD83 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-CD83 Antibody Target Details CD83 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-CD83 antibody (CD83) (ABIN4296241) Immunohistochemistry: CD83 Antibody [NBP2-38485] - Staining of human tonsil shows dis...
Immunofluorescence (IF) image for anti-CD83 antibody (CD83) (ABIN4296241) Immunocytochemistry/Immunofluorescence: CD83 Antibody [NBP2-38485] - Immunofluorescen...