anti-Human IL17A antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended IL17A Antibody (supplied by: Log in to see )

Interleukin 17A (IL17A) Antibodies
  • CTLA8
  • IL-17
  • IL-17A
  • IL17
  • Ctla-8
  • Ctla8
  • Il17
  • ChIL-17
  • IL-17F
  • IL17A
  • CTLA-8
  • interleukin 17A
  • IL17A
  • Il17a
This IL17A antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4324633
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1490779 IHC (p) WB Mouse IgG2b, kappa AA 1-75 Log in to see 4K5F6
1 ABIN116119 EIA Func IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN116120 EIA Func IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN1102463 IHC (p) Neut ELISA WB Rabbit IgG Log in to see Polyclonal
1 ABIN181572 EIA IHC (p) Neut WB Goat Log in to see Polyclonal
1 ABIN5580751 FACS IHC (p) WB Mouse IgG2b kappa Log in to see 4K5F6


Antigen Interleukin 17A (IL17A) Antibodies
Reactivity Human
(372), (133), (41), (7), (7), (5), (3), (3), (2), (2)
Host Rabbit
(248), (132), (77), (40), (3), (3)
Conjugate This IL17A antibody is un-conjugated
(56), (32), (27), (22), (20), (16), (15), (15), (11), (11), (7), (7), (7), (7), (7), (5), (5), (5), (4), (4), (4), (4), (4), (4), (3), (2), (2), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(269), (229), (195), (42), (30), (19), (19), (16), (8), (8), (7), (7), (7), (6), (6), (4), (4), (4), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-IL17A Antibody

Target Details IL17A Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: NPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRN EDPERYPSVIWEAKCRHLGCIN
Isotype IgG

Target Details IL17A

Product Details anti-IL17A Antibody Application Details Handling Images back to top
Alternative Name IL-17/IL-17A (IL17A Antibody Abstract)
Background Gene Symbol: IL17A
Gene ID 3605

Application Details

Product Details anti-IL17A Antibody Target Details IL17A Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-IL17A Antibody Target Details IL17A Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-IL17A Antibody Target Details IL17A Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Interleukin 17A (IL17A) antibody (ABIN4324633) Immunohistochemistry-Paraffin: IL-17/IL-17A Antibody [NBP2-14121] - Staining of human...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Interleukin 17A (IL17A) antibody (ABIN4324633) Immunohistochemistry-Paraffin: IL-17/IL-17A Antibody [NBP2-14121] - Staining of human...