You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human IL17A antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended IL17A Antibody (supplied by: Log in to see )

Antigen
Interleukin 17A (IL17A) Antibodies
  • ChIL-17
  • Ctla-8
  • CTLA-8
  • CTLA8
  • Ctla8
  • IL-17
  • IL-17A
  • IL-17F
  • IL17
  • Il17
  • IL17A
Reactivity
Human
430
195
72
10
5
5
1
Host
Rabbit
248
206
112
44
8
3
1
Clonality
Polyclonal
Conjugate
This IL17A antibody is un-conjugated
71
34
34
24
17
16
14
11
8
7
7
7
7
7
7
7
7
7
6
6
5
5
4
3
3
3
2
2
2
2
2
2
2
2
2
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
345
313
193
58
42
42
24
22
19
15
11
10
9
9
9
8
7
6
5
4
4
3
2
2
2
2
2
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4324633
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.0008919152 ABIN677933 IF (p) IHC (p) Rabbit IgG AA 40-80 Log in to see Polyclonal 2
0.0008919152 ABIN116120 EIA Func IHC (p) WB Rabbit Log in to see Polyclonal
0.0008919152 ABIN116119 EIA Func IHC (p) WB Rabbit Log in to see Polyclonal
0.0008919152 ABIN1490779 FACS IHC (p) WB Mouse IgG2b, kappa AA 1-75 Log in to see 4K5F6
0.0008919152 ABIN677935 IHC (p) Biotin Rabbit IgG AA 40-80 Log in to see Polyclonal
0.0008919152 ABIN1102463 IHC (p) Neut ELISA WB Rabbit IgG Log in to see Polyclonal
0.0008919152 ABIN677942 IHC (p) HRP Rabbit IgG AA 40-80 Log in to see Polyclonal
0.0008919152 ABIN181572 EIA IHC (p) Neut WB Goat Log in to see Polyclonal
0.0008919152 ABIN1859349 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG AA 20-155 Log in to see Polyclonal
0.0008919152 ABIN2474941 Func IF IHC (p) ELISA WB Rabbit IgG Log in to see Polyclonal 2
0.0008919152 ABIN1735873 IHC (p) ELISA WB Rabbit IgG Log in to see Polyclonal
0.0008919152 ABIN1724215 FACS IHC (p) WB Mouse IgG2b kappa AA 1-75 Log in to see 4K5F6
0.0008919152 ABIN2769160 IHC (p) IHC WB Mouse IgG2b, kappa AA 1-75 Log in to see 4K5F6
0.0008919152 ABIN2764807 IHC (p) IHC ELISA WB Rabbit IgG Log in to see Polyclonal

Top referenced anti-IL17A antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-IL17A Antibodies

Application / Reactivity Human
Biochemical Assay (BCA) 3 Antibodies
Blocking Antibody (Inhibition) 3 Antibodies
Blocking Reagent (BR) 2 Antibodies
Confocal Microscopy (CM) 2 Antibodies
Depletion (Dep) 1 Antibodies
ELISA 193 Antibodies
ELISA (Capture) 7 Antibodies
ELISA (Detection) 8 Antibodies
ELISpot 9 Antibodies
ELISpot (Capture) (ELISPOT (Capture)) 3 Antibodies
ELISpot (Detection) (ELISPOT (Detection)) 1 Antibodies
Enzyme Immunoassay (EIA) 11 Antibodies
Flow Cytometry (FACS) 118 Antibodies
Functional Studies (Func) 9 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 5 Antibodies
Immunofluorescence (IF) 10 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies

General

Antigen Interleukin 17A (IL17A) Antibodies
Reactivity Human
(430), (195), (72), (10), (5), (5), (1)
Host Rabbit
(248), (206), (112), (44), (8), (3), (1)
Clonality
Polyclonal
Conjugate This IL17A antibody is un-conjugated
(71), (34), (34), (24), (17), (16), (14), (11), (8), (7), (7), (7), (7), (7), (7), (7), (7), (7), (6), (6), (5), (5), (4), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(345), (313), (193), (58), (42), (42), (24), (22), (19), (15), (11), (10), (9), (9), (9), (8), (7), (6), (5), (4), (4), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-IL17A Antibody

Target Details IL17A Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: NPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRN EDPERYPSVIWEAKCRHLGCIN
Isotype IgG

Target Details IL17A

Product Details anti-IL17A Antibody Application Details Handling Images back to top
Antigen
Alternative Name IL-17/IL-17A (IL17A Antibody Abstract)
Background Gene Symbol: IL17A
Pathways TCR Signaling

Application Details

Product Details anti-IL17A Antibody Target Details IL17A Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-IL17A Antibody Target Details IL17A Application Details Images back to top
Format Liquid
Buffer 40 % glycerol and PBS pH 7.2.
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-IL17A Antibody Target Details IL17A Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-IL17A antibody (Interleukin 17A) (ABIN4324633) Immunohistochemistry-Paraffin: IL-17/IL-17A Antibody [NBP2-14121] - Staining of human...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-IL17A antibody (Interleukin 17A) (ABIN4324633) Immunohistochemistry-Paraffin: IL-17/IL-17A Antibody [NBP2-14121] - Staining of human...