You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human IGFBP5 antibody for Western Blotting

Recommended IGFBP5 Antibody (supplied by: Log in to see )

Insulin-Like Growth Factor Binding Protein 5 (IGFBP5) Antibodies
  • AI256729
  • AW208790
  • IBP-5
  • IBP5
  • ibp5
  • IGF-BP5
  • IGFBP-5
  • IGFBP-5P
  • IGFBP5
  • igfbp5
  • xIGFBP-5
AA 76-114, N-Term
This IGFBP5 antibody is un-conjugated
ELISA, Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN3042733
$ 240.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.12917753 ABIN2785660 WB Rabbit Middle Region Log in to see Polyclonal
0.12917753 ABIN1873175 IHC WB Rabbit IgG Log in to see Polyclonal
0.12917753 ABIN2862628 WB Rabbit IgG Log in to see Polyclonal
0.12917753 ABIN3022436 IHC WB Rabbit IgG Log in to see Polyclonal
0.12917753 ABIN181656 EIA WB Rabbit Log in to see Polyclonal
0.12917753 ABIN1078203 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG AA 27-248 Log in to see Polyclonal
0.12917753 ABIN1859309 ICC IHC (fro) IHC (p) ELISA WB Mouse IgG AA 27-248 Log in to see
0.12917753 ABIN1989511 WB Mouse AA 1-272, full length Log in to see Polyclonal
0.12917753 ABIN2404554 IHC WB Rabbit IgG Log in to see Polyclonal
0.12917753 ABIN4321650 WB Rabbit Log in to see Polyclonal
0.0011819942 ABIN962581 IHC (p) WB Rabbit IgG AA 192-206 Log in to see Polyclonal
0.0011819942 ABIN181507 WB Rabbit Log in to see Polyclonal
0.0011819942 ABIN668213 IF (p) IHC (p) WB Rabbit IgG AA 90-140 Log in to see Polyclonal
0.0011819942 ABIN1889559 IHC WB Mouse IgG2 AA 28-272 Log in to see MM0344-8D21
0.0011819942 ABIN411513 WB Rabbit IgG Log in to see Polyclonal
0.0011819942 ABIN1582267 IHC ELISA WB Rabbit N-Term Log in to see Polyclonal
0.0011819942 ABIN668215 IHC (p) WB Biotin Rabbit IgG AA 90-140 Log in to see Polyclonal
0.0011819942 ABIN668222 IHC (p) WB HRP Rabbit IgG AA 90-140 Log in to see Polyclonal
0.0011819942 ABIN1735787 IHC (p) WB Rabbit IgG AA 192-206 Log in to see Polyclonal
0.0011819942 ABIN1498816 IHC (p) ELISA WB Rabbit Log in to see Polyclonal

Similar anti-IGFBP5 Antibodies

Application / Reactivity Human
Blocking Antibody (Inhibition) 1 Antibodies
ELISA 37 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies
Immunohistochemistry (IHC) 28 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 2 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 10 Antibodies
Immunoprecipitation (IP) 2 Antibodies
Western Blotting (WB) 66 Antibodies


Antigen Insulin-Like Growth Factor Binding Protein 5 (IGFBP5) Antibodies
Epitope AA 76-114, N-Term
(13), (12), (10), (4), (3), (3), (1), (1), (1), (1), (1)
Reactivity Human
(88), (38), (33), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Host Rabbit
(83), (18), (5), (4)
Conjugate This IGFBP5 antibody is un-conjugated
(14), (7), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application ELISA, Western Blotting (WB)
(78), (51), (32), (13), (11), (6), (5), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-IGFBP5 Antibody

Target Details IGFBP5 Application Details Handling Images
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 5(IGFBP5) detection. Tested with WB, ELISA in Human.
Gene Name: insulin-like growth factor binding protein 5
Protein Name: Insulin-like growth factor-binding protein 5
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human IGFBP5 (76-114aa QGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIER), different from the related mouse and rat sequences by two amino acids.
Isotype IgG

Target Details IGFBP5

Product Details anti-IGFBP5 Antibody Application Details Handling Images back to top
Alternative Name IGFBP5 (IGFBP5 Antibody Abstract)
Background Insulin-like growth factor-binding protein 5 is a protein that in humans is encoded by the IGFBP5 gene. The expression of IGFBP5 by stable transfection and adenovirus-mediated infection is inhibitory to growth in 2 human breast cancer cell lines. IGFBP5 expression leads to G2/M cell cycle arrest and apoptosis. Stable expression of IGFBP5 in the breast cancer cell lines also inhibits the formation and growth of tumors following injection in athymic mice. It is concluded that IGFBP5 is a growth inhibitor and proapoptotic agent in breast cancer cells. Additionally, IGFBP-5 is expressed by fibroblasts, myoblasts and osteoblasts, making it the predominant IGFBP found in bone extracts. It has a strong affinity for hydroxyapatite, allowing it to bind to bone cells. When bound to extracellular matrix, IGFBP-5 is protected from proteolysis and potentiates IGF activity, but when it is soluble, IGFBP-5 is cleaved to a biologically inactive 21 kDa fragment (1, 2).
Gene ID 3488
UniProt P24593
Research Area Signaling, Diabetes, Metabolism, Growth Factors
Pathways WNT Signaling

Application Details

Product Details anti-IGFBP5 Antibody Target Details IGFBP5 Handling Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions For Research Use only


Product Details anti-IGFBP5 Antibody Target Details IGFBP5 Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C,4 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.


Product Details anti-IGFBP5 Antibody Target Details IGFBP5 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-IGFBP5 antibody (Insulin-Like Growth Factor Binding Protein 5) (AA 76-114) (ABIN3042733) Observed bind size: 23KD