You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) WNT5A antibody for Immunochromatography

Recommended WNT5A Antibody (supplied by: Log in to see )

Antigen
Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A) Antibodies
  • 8030457G12Rik
  • hWNT5A
  • wnt-5A
  • Wnt-5a
  • WNT5A
  • wnt5a-B
Epitope
AA 62-381
15
14
13
10
5
3
3
2
2
2
1
1
1
1
1
1
1
1
1
Reactivity
Mouse (Murine)
87
34
24
13
1
1
1
1
1
Host
Rabbit
65
31
1
1
Clonality
Polyclonal
Conjugate
This WNT5A antibody is un-conjugated
5
4
3
2
2
2
1
1
1
1
1
1
1
1
1
Application
Immunochromatography (IC), Immunohistochemistry (IHC), ELISA, Western Blotting (WB)
75
51
48
19
16
11
10
3
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Catalog No. ABIN2387017
$ 608.14
Plus shipping costs $45.00

Similar anti-WNT5A Antibodies

Application / Reactivity Mouse (Murine)
ELISA 7 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies
Immunohistochemistry (IHC) 11 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 5 Antibodies
Western Blotting (WB) 20 Antibodies

General

Antigen Wingless-Type MMTV Integration Site Family, Member 5A (WNT5A) Antibodies
Epitope AA 62-381
(15), (14), (13), (10), (5), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Mouse (Murine)
(87), (34), (24), (13), (1), (1), (1), (1), (1)
Host Rabbit
(65), (31), (1), (1)
Clonality
Polyclonal
Conjugate This WNT5A antibody is un-conjugated
(5), (4), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunochromatography (IC), Immunohistochemistry (IHC), ELISA, Western Blotting (WB)
(75), (51), (48), (19), (16), (11), (10), (3), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-WNT5A Antibody

Target Details WNT5A Application Details Handling Images
Sequence MSPILGYWKI KGLVQPTRLL LEYLEEKYEE HLYERDEGDK WRNKKFELGL EFPNLPYYID GDVKLTQSMA IIRYIADKHN MLGGCPKERA EISMLEGAVL DIRYGVSRIA YSKDFETLKV DFLSKLPEML KMFEDRLCHK TYLNGDHVTH PDFMLYDALD VVLYMDPMCL DAFPKLVCFK KRIEAIPQID KYLKSSKYIA WPLQGWQATF GGGDHPPKSD LEVLFQGPLG SPEF-IIGAQPLCSQ LAGLSQGQK KLCHLYQDHM QYIGEGAKTG IKECQYQFRH RRWNCSTVDN TSVFGRVMQI GSRETAFTYA VSAAGVVNAM SRACREGELS TCGCSRAARP KDLPRDWLWG GCGDNIDYGY RFAKEFVDAR ERERIHAKGS YESARILMNL HNNEAGRRTV YNLADVACKC HGVSGSCSLK TCWLQLADFR KVGDALKEKY DSAAAMRLNS RGKLVQVNSR FNSPTTQDLV YIDPSPDYCV RNESTGSLGT QGRLCNKTSE GMDGCELMCC GRGYDQFKTV QTERCHCKFH WCCYVKCKKC TEIVDQFVCK
Cross-Reactivity Mouse (Murine)
Cross-Reactivity (Details) Calculated cross reactivity: Mo
Characteristics Wingless Type MMTV Integration Site Family, Member 5A (WNT5A)
Purification Purified by immunoaffinity chromatography.
Immunogen WNT5A (Ile62~Lys381), MSPILGYWKI KGLVQPTRLL LEYLEEKYEE HLYERDEGDK WRNKKFELGL EFPNLPYYID GDVKLTQSMA IIRYIADKHN MLGGCPKERA EISMLEGAVL DIRYGVSRIA YSKDFETLKV DFLSKLPEML KMFEDRLCHK TYLNGDHVTH PDFMLYDALD VVLYMDPMCL DAFPKLVCFK KRIEAIPQID KYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEF-IIGAQPLCS QLAGLSQGQK KLCHLYQDHM QYIGEGAKTG IKECQYQFRH RRWNCSTVDN TSVFGRVMQI GSRETAFTYA VSAAGVVNAM SRACREGELS TCGCSRAARP KDLPRDWLWG GCGDNIDYGY RFAKEFVDAR ERERIHAKGS YESARILMNL HNNEAGRRTV YNLADVACKC HGVSGSCSLK TCWLQLADFR KVGDALKEKY DSAAAMRLNS RGKLVQVNSR FNSPTTQDLV YIDPSPDYCV RNESTGSLGT QGRLCNKTSE GMDGCELMCC GRGYDQFKTV QTERCHCKFH WCCYVKCKKC TEIVDQFVCK
Isotype IgG

Target Details WNT5A

Product Details anti-WNT5A Antibody Application Details Handling Images back to top
Antigen
Alternative Name Wingless Type MMTV Integration Site Family, Member 5A (WNT5A Antibody Abstract)
Pathways WNT Signaling

Application Details

Product Details anti-WNT5A Antibody Target Details WNT5A Handling Images back to top
Application Notes Optimal working conditions should be determined by the investigator.
Restrictions For Research Use only

Handling

Product Details anti-WNT5A Antibody Target Details WNT5A Application Details Images back to top
Format Liquid
Buffer Supplied as a liquid in PBS, pH 7.2, 0.05 % sodium azide, 50 % glycerol.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment -20°C