Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

IVNS1ABP antibody (N-Term)

This Rabbit Polyclonal antibody specifically detects IVNS1ABP in WB and IHC (p). It exhibits reactivity toward Human, Mouse, Rat, Dog, Cow, Zebrafish (Danio rerio), Pig and Xenopus laevis.
Catalog No. ABIN1107889

Quick Overview for IVNS1ABP antibody (N-Term) (ABIN1107889)

Target

See all IVNS1ABP Antibodies
IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))

Reactivity

  • 15
  • 5
  • 4
  • 4
  • 3
  • 3
  • 3
  • 2
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
Human, Mouse, Rat, Dog, Cow, Zebrafish (Danio rerio), Pig, Xenopus laevis

Host

  • 15
  • 1
Rabbit

Clonality

  • 15
  • 1
Polyclonal

Conjugate

  • 13
  • 1
  • 1
  • 1
This IVNS1ABP antibody is un-conjugated

Application

  • 12
  • 8
  • 7
  • 3
  • 2
  • 2
  • 1
  • 1
Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
  • Binding Specificity

    • 4
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term

    Sequence

    MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVL

    Cross-Reactivity (Details)

    Species reactivity (expected):Mouse, Dog, Rat, African clawed frog, Bovine, Pig, ZebrafishSpecies reactivity (tested):Human

    Purification

    Purified using Protein A affinity column

    Immunogen

    The immunogen for anti-IVNS1ABP antibody: synthetic peptide directed towards the N terminal of human IVNS1ABP.
  • Application Notes

    Optimal working dilution should be determined by the investigator.

    Restrictions

    For Research Use only
  • Reconstitution

    Add 100 μL of distilled water to a final concentration of 1 mg/mL.

    Handling Advice

    Avoid repeated freezing and thawing.

    Storage

    4 °C/-20 °C

    Storage Comment

    Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.
  • Target

    IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))

    Alternative Name

    IVNS1ABP

    Target Type

    Influenza Protein

    Background

    This gene encodes a protein which interacts with the nonstructural NS1 protein of the influenza A virus. In noninfected cells, affinity-purified antibodies localized this protein in nuclear regions enriched with the spliceosome assembly factor SC35, suggesting an association with the cellular splicing apparatus. In influenza A virus-infected cells, the protein relocalized throughout the nucleoplasm and appeared distinct from the SC35 domains, which suggests that its function may be disturbed or altered.Synonyms: ARA3, Aryl hydrocarbon receptor-associated protein 3, FLARA3, HSPC068, Influenza virus NS1A-binding protein, KIAA0850, NS1, NS1-binding protein, NS1BP

    Gene ID

    10625

    NCBI Accession

    NP_006460

    Pathways

    Negative Regulation of intrinsic apoptotic Signaling
You are here:
Chat with us!