IVNS1ABP antibody (Influenza Virus NS1A Binding Protein) (N-Term)

Details for Product anti-IVNS1ABP Antibody No. ABIN1107889
Target
Binding Specificity
N-Term
3
1
1
1
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat, Xenopus laevis, Zebrafish (Danio rerio)
9
5
3
3
3
3
3
2
2
2
2
1
1
1
1
Host
Rabbit
9
1
Clonality
Polyclonal
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
10
7
4
2
1
Options
Immunogen The immunogen for anti-IVNS1ABP antibody: synthetic peptide directed towards the N terminal of human IVNS1ABP.
Sequence MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVL
Cross-Reactivity (Details) Species reactivity (expected):Mouse, Dog, Rat, African clawed frog, Bovine, Pig, ZebrafishSpecies reactivity (tested):Human
Purification Purified using Protein A affinity column
Target
Alternative Name IVNS1ABP (IVNS1ABP Antibody Abstract)
Background This gene encodes a protein which interacts with the nonstructural NS1 protein of the influenza A virus. In noninfected cells, affinity-purified antibodies localized this protein in nuclear regions enriched with the spliceosome assembly factor SC35, suggesting an association with the cellular splicing apparatus. In influenza A virus-infected cells, the protein relocalized throughout the nucleoplasm and appeared distinct from the SC35 domains, which suggests that its function may be disturbed or altered.Synonyms: ARA3, Aryl hydrocarbon receptor-associated protein 3, FLARA3, HSPC068, Influenza virus NS1A-binding protein, KIAA0850, NS1, NS1-binding protein, NS1BP
Gene ID 10625
NCBI Accession NP_006460
Pathways Negative Regulation of intrinsic apoptotic Signaling
Application Notes Optimal working dilution should be determined by the investigator.
Restrictions For Research Use only
Reconstitution Add 100 μL of distilled water to a final concentration of 1 mg/mL.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.
Images
Image no. 1 for anti-Influenza Virus NS1A Binding Protein (IVNS1ABP) (N-Term) antibody (ABIN1107889) Human Stomach; IVNS1ABP antibody - N-terminal region in Human Stomach cells using Imm...
Image no. 2 for anti-Influenza Virus NS1A Binding Protein (IVNS1ABP) (N-Term) antibody (ABIN1107889) Human HepG2; WB Suggested Anti-IVNS1ABP Antibody Titration: 2.0ug/ml. Positive Contro...