GRIA2 antibody (AA 834-883)

Catalog No. ABIN1304677

This Mouse Monoclonal antibody specifically detects GRIA2 in WB, IHC, IP, ICC and IEM. It exhibits reactivity toward Ratand has been mentioned in 1 publication.

Quick Overview for GRIA2 antibody (AA 834-883) (ABIN1304677)

Target: GRIA2 (Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2))

Reactivity: Rat

Host: Mouse

Clonality: Monoclonal

Conjugate: This GRIA2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC), Immunoelectron Microscopy (IEM)

Clone: L21-32

Product Details anti-GRIA2 Antibody

Binding Specificity: AA 834-883

Specificity: No off-targets reported for GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results)

Cross-Reactivity: Human, Mouse, Rat

Characteristics:

Description: Our Anti-GluA2/GluR2 glutamate receptor mouse monoclonal primary antibody is produced in-house from hybridoma clone L21/32. It is KO validated, detects human, mouse, and rat GluA2/GluR2 glutamate receptor, and is purified by Protein A chromatography. It is great for use in EM, IHC, ICC, IP, WB.

Manufacturer Comment: We produce our GluA2/GluR2 glutamate receptor mouse monoclonal primary antibody from hybridoma clone L21/32. It is great in EM, IHC, ICC, IP, WB and is purified by Protein A chromatography.

Purification: Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography.

Purity: > 90% specific antibody

Immunogen: Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli

Isotype: IgG1

Application Details

Application Notes:

Dilution Range: IHC: 1:250

Dilution Range: ICC: 1:500

Dilution Range: WB: 1:500

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 1 mg/mL

Buffer: 10 mM Tris, 50 mM Sodium Chloride, 0.065 % Sodium Azide pH 7.4

Storage: 4 °C,-20 °C

Storage Comment: Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.

Expiry Date: 24 months

References for anti-GRIA2 antibody (ABIN1304677)

Gonzalez-Lozano, Klemmer, Gebuis, Hassan, van Nierop, van Kesteren, Smit, Li: "Dynamics of the mouse brain cortical synaptic proteome during postnatal brain development." in: Scientific reports, Vol. 6, pp. 35456, (2016) (PubMed).

Target Details for GRIA2

Target: GRIA2 (Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2))

Alternative Name: GluR2 glutamate receptor

Background:

Synonyms: Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)

Target Description: Glutelin type-A 2 (GluA2) , also called GRIA2, GLUR2, GLURB, GluA2, GluR-K2, HBGR2 or glutamate ionotropic receptor AMPA type subunit 2, is a member of the Glutamate receptor family of the mammalian brain. This neurotransmiter receptor subunit, which is activated during normal central nervous system fuction, is encoded by the GRIA2 (or GLUR2) gene. GluA2 constitutes a key subunit that regulates AMPA receptors. AMPA receptors lacking of Glua2 have been shown to be present in diseased brains, whose basic fuctions have been altered.

Gene Name Alternatives: Gria2 Glur2

Molecular Weight: 90 kDa

UniProt: P19491

Pathways: PI3K-Akt Signaling