SSX4B antibody (Synovial Sarcoma, X Breakpoint 4B) (AA 1-188)

Details for Product anti-SSX4B Antibody No. ABIN1327392
Target
Binding Specificity
AA 1-188
1
Reactivity
Human
1
Host
Mouse
1
Clonality
Polyclonal
Application
Western Blotting (WB)
1
Options
Purpose Mouse polyclonal antibody raised against a full-length human SSX4B protein.
Immunogen

immunogen: SSX4B (AAI53139.1, 1 a.a. ~ 188 a.a) full-length human protein.

Immunogen Sequence: MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPFMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE

Cross-Reactivity Human
Target
Alternative Name SSX4B (SSX4B Antibody Abstract)
Background Full Gene Name: synovial sarcoma, X breakpoint 4B
Synonyms: MGC169015,MGC169016
Gene ID 548313
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Synovial Sarcoma, X Breakpoint 4B (SSX4B) (AA 1-188) antibody (ABIN1327392) Western Blot analysis of SSX4B expression in transfected 293T cell line by SSX4B MaxP...