Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

SSX4B antibody (Synovial Sarcoma, X Breakpoint 4B) (AA 1-188) Primary Antibody

SSX4B Reactivity: Human WB Host: Mouse Polyclonal
Catalog No. ABIN1327392
$440.00
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Binding Specificity
    AA 1-188
    Reactivity
    Human
    Host
    Mouse
    Clonality
    Polyclonal
    Application
    Western Blotting (WB)
    Purpose
    Mouse polyclonal antibody raised against a full-length human SSX4B protein.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: SSX4B (AAI53139.1, 1 a.a. ~ 188 a.a) full-length human protein.

    Immunogen Sequence: MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPFMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody reactive against mammalian transfected lysate.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    Alternative Name
    SSX4B (SSX4B Antibody Abstract)
    Background
    Full Gene Name: synovial sarcoma, X breakpoint 4B
    Synonyms: MGC169015,MGC169016
    Gene ID
    548313
You are here: