IL21 Receptor antibody (N-Term)

Catalog No. ABIN2288648

The Rabbit Polyclonal anti-IL21 Receptor antibody is suitable to detect IL21 Receptor in samples from Mouse. It has been validated for ELISA, IHC and FACS.

Quick Overview for IL21 Receptor antibody (N-Term) (ABIN2288648)

Target: IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))

Reactivity: Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL21 Receptor antibody is un-conjugated

Application: ELISA, Immunohistochemistry (IHC), Flow Cytometry (FACS)

Product Details anti-IL21 Receptor Antibody

Binding Specificity: N-Term

Sequence: CVLETRSPNP SILSLTWQDE YEELQDQETF

Cross-Reactivity: Mouse (Murine)

Cross-Reactivity (Details): Calculated cross reactivity: Mo

Characteristics: Interleukin 21 Receptor (IL-21)

Purification: Purified by immunoaffinity chromatography.

Immunogen: Synthetic peptide CVLETRSPNPSILSLTWQDEYEELQDQETF corresponding to 35-65 residues of N-terminus of mouseIL-21 receptor.

Isotype: IgG

Application Details

Application Notes: Optimal working conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: Supplied as a liquid in PBS, pH 7.2, 0.09 % sodium azide before the addition of 40 % glycerol.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: -20 °C

Storage Comment: -20°C

Target Details for IL21 Receptor

Target: IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))

Alternative Name: Interleukin 21 Receptor

Pathways: JAK-STAT Signaling