Caspase 2 antibody (AA 378-409)

Catalog No. ABIN2738755

The Rabbit Polyclonal anti-Caspase 2 antibody (ABIN2738755) specifically detects Caspase 2 in WB. The antibody is reactive with Human, Mouse, Rat, Monkey, Guinea Pig, Chimpanzee, Gibbon and Orang-Utan samples.

Quick Overview for Caspase 2 antibody (AA 378-409) (ABIN2738755)

Target: Caspase 2 (CASP2) (Caspase 2, Apoptosis-Related Cysteine Peptidase (CASP2))

Reactivity: Human, Mouse, Rat, Monkey, Guinea Pig, Chimpanzee, Gibbon, Orang-Utan

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Caspase 2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Caspase 2 Antibody

Binding Specificity: AA 378-409

Specificity: Expressed at higher levels in the embryonic lung, liver and kidney than in the heart and brain. In adults, higher level expression is seen in the placenta, lung, kidney, and pancreas than in the heart, brain, liver and skeletal muscle.

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CASP2(378-409aa RNTKRGSWYIEALAQVFSERACDMHVADMLVK), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for Caspase 2

Target: Caspase 2 (CASP2) (Caspase 2, Apoptosis-Related Cysteine Peptidase (CASP2))

Alternative Name: CASP2 / Caspase 2

Background: Name/Gene ID: CASP2
Subfamily: Cysteine C14
Family: Protease

Synonyms: CASP2, CASP-2, Caspase-2, PPP1R57, Protease ICH-1, NEDD-2, Caspase 2, ICH1, NEDD2

Gene ID: 835

Pathways: Apoptosis, Caspase Cascade in Apoptosis, Neurotrophin Signaling Pathway