CD36 antibody (AA 31-66)

Catalog No. ABIN2739295

This anti-CD36 antibody is a Rabbit Polyclonal antibody detecting CD36 in WB, IHC and IHC (p). Suitable for Human, Mouse and Rat.

Quick Overview for CD36 antibody (AA 31-66) (ABIN2739295)

Target: CD36

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CD36 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-CD36 Antibody

Binding Specificity: AA 31-66

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CD36 (31-66aa DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW), different from the related mouse sequence by six amino acids, and from the related rat sequence by four amino acids.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for CD36

Target: CD36

Alternative Name: CD36

Background: Name/Gene ID: CD36

Synonyms: CD36, Cluster determinant 36, FAT, Fatty acid translocase, Glycoprotein IIIb, gp4, GPIIIB, GPIV, PAS-4 protein, PAS IV, PASIV, Platelet collagen receptor, Platelet glycoprotein IV, SCARB3, Thrombospondin receptor, BDPLT10, CD36 antigen, CHDS7, gp3B, PAS-4, Platelet glycoprotein 4

Gene ID: 948

Pathways: TLR Signaling, Peptide Hormone Metabolism, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Regulation of Lipid Metabolism by PPARalpha, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Hepatitis C, Toll-Like Receptors Cascades, Lipid Metabolism, S100 Proteins