OTX2 antibody (AA 258-289)

Catalog No. ABIN2743418

The Rabbit Polyclonal anti-OTX2 antibody has been validated for WB. It is suitable to detect OTX2 in samples from Human, Rat, Mouse, Dog, Sheep, Rabbit, Horse, Cow, Bat, Hamster, Pig, Xenopus laevis, Chicken, Chimpanzee, Gibbon, Monkey and Orang-Utan.

Quick Overview for OTX2 antibody (AA 258-289) (ABIN2743418)

Target: OTX2 (Orthodenticle Homeobox 2 (OTX2))

Reactivity: Human, Rat, Mouse, Dog, Sheep, Rabbit, Horse, Cow, Bat, Hamster, Pig, Xenopus laevis, Chicken, Chimpanzee, Gibbon, Monkey, Orang-Utan

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OTX2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-OTX2 Antibody

Binding Specificity: AA 258-289

Specificity: Expressed in brain.

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Otx2 (258-289aa DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL), identical to the related mouse sequence.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for OTX2

Target: OTX2 (Orthodenticle Homeobox 2 (OTX2))

Alternative Name: OTX2

Background: Name/Gene ID: OTX2

Synonyms: OTX2, CPHD6, Homeobox protein OTX2, MCOPS5, Orthodenticle homeobox 2, Orthodenticle homolog 2

Gene ID: 5015

Pathways: Dopaminergic Neurogenesis