PIM1 antibody (AA 373-404)

Catalog No. ABIN2743635

This anti-PIM1 antibody is a Rabbit Polyclonal antibody detecting PIM1 in WB. Suitable for Human, Horse, Sheep, Monkey, Chimpanzee and Gibbon.

Quick Overview for PIM1 antibody (AA 373-404) (ABIN2743635)

Target: PIM1 (Pim-1 Oncogene (PIM1))

Reactivity: Human, Horse, Sheep, Monkey, Chimpanzee, Gibbon

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIM1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PIM1 Antibody

Binding Specificity: AA 373-404

Specificity: Expressed primarily in cells of the hematopoietic and germline lineages. Isoform 1 and isoform 2 are both expressed in prostate cancer cell lines. .

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PIM1(373-404aa EEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK), different from the related mouse sequence by seven amino acids and from the related rat sequence by two amino acids.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for PIM1

Target: PIM1 (Pim-1 Oncogene (PIM1))

Alternative Name: PIM1 / Pim-1

Background: Name/Gene ID: PIM1
Subfamily: PIM
Family: Protein Kinase

Synonyms: PIM1, Pim-1 kinase 44 kDa isoform, Proviral integration site 1, Oncogene PIM1, PIM, Pim-1, Pim-1 oncogene

Gene ID: 5292

Pathways: Glycosaminoglycan Metabolic Process