EWSR1 antibody (Middle Region)

Catalog No. ABIN3043825

Product Details anti-EWSR1 Antibody

Target: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Binding Specificity: AA 369-399, Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EWSR1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for RNA-binding protein EWS(EWSR1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: NDSVTLDDLA DFFKQCGVVK MNKRTGQPMI H

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for RNA-binding protein EWS(EWSR1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: EWS RNA-binding protein 1
Protein Name: RNA-binding protein EWS

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for EWSR1

Target: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Alternative Name: EWSR1 (EWSR1 Products)

Synonyms: EWS antibody, bK984G1.4 antibody, AU018891 antibody, Ews antibody, Ewsh antibody, EWSR1 antibody, fc04c01 antibody, wu:fc04c01 antibody, DKFZp459K1116 antibody, ewsr1 antibody, ewsr1.S antibody, fb40b11 antibody, fusl antibody, wu:fb40b11 antibody, wu:fb75g09 antibody, zgc:55864 antibody, EWS RNA binding protein 1 antibody, Ewing sarcoma breakpoint region 1 antibody, EWS RNA-binding protein 1 antibody, EWS RNA-binding protein 1a antibody, EWS RNA binding protein 1 L homeolog antibody, EWS RNA-binding protein 1b antibody, EWSR1 antibody, Ewsr1 antibody, ewsr1a antibody, ewsr1 antibody, ewsr1.L antibody, ewsr1b antibody

Background: This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.

Synonyms: bK984G1.4 antibody|bK984G1.4 Ewing sarcoma breakpoint region 1 protein antibody|Ewing sarcoma breakpoint region 1 antibody|Ewing sarcoma breakpoint region 1 protein antibody|Ewings sarcoma EWS Fli1 type 1 oncogene antibody|EWS antibody|EWS oncogene antibody| EWS RNA binding protein 1 antibody|EWS_HUMAN antibody|EWSR 1 antibody|Ewsr1 antibody|EWSR1 protein antibody|RNA binding protein EWS antibody|RNA-binding protein EWS antibody

Gene ID: 2130

UniProt: Q01844