Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

HIF1A antibody (Hypoxia Inducible Factor 1, alpha Subunit (Basic Helix-Loop-Helix Transcription Factor)) (AA 703-732) Primary Antibody

HIF1A Reactivity: Human, Mouse, Rat IHC (p), WB Host: Rabbit Polyclonal unconjugated
Pubmed (33)
Catalog No. ABIN3043841
$280.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 4 to 6 Business Days
  • Target
    HIF1A
    Binding Specificity
    • 19
    • 19
    • 16
    • 16
    • 14
    • 11
    • 9
    • 7
    • 7
    • 6
    • 6
    • 5
    • 5
    • 4
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 703-732, C-Term
    Reactivity
    • 204
    • 94
    • 92
    • 36
    • 21
    • 16
    • 13
    • 9
    • 9
    • 8
    • 8
    • 7
    • 6
    • 6
    • 5
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 170
    • 67
    • 5
    Rabbit
    Clonality
    • 174
    • 68
    Polyclonal
    Conjugate
    • 128
    • 29
    • 17
    • 9
    • 6
    • 4
    • 4
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This HIF1A antibody is un-conjugated
    Application
    • 172
    • 96
    • 77
    • 65
    • 49
    • 37
    • 35
    • 29
    • 26
    • 26
    • 12
    • 10
    • 7
    • 5
    • 4
    • 3
    • 2
    • 2
    • 2
    • 1
    Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
    Purpose
    Rabbit IgG polyclonal antibody for Hypoxia-inducible factor 1-alpha(HIF1A) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Sequence
    EEELNPKILA LQNAQRKRKM EHDGSLFQAV
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for Hypoxia-inducible factor 1-alpha(HIF1A) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
    Protein Name: Hypoxia-inducible factor 1-alpha
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminal of human HIF-1-alpha (703-732aa EEELNPKILALQNAQRKRKMEHDGSLFQAV), different from the related mouse and rat sequences by three amino acids.
    Isotype
    IgG
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, The detection limit for HIF-1-alpha is approximately 0.25 ng/lane under reducing conditions.
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handling Advice
    Avoid repeated freezing and thawing.
    Storage
    4 °C/-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Wang, Yuan, Wang, Yang, Chen, Liu, Song, Feng, Tan, Jia: "Anti-inflammatory Effects of Phyllanthus emblica L on Benzopyrene-Induced Precancerous Lung Lesion by Regulating the IL-1β/miR-101/Lin28B Signaling Pathway." in: Integrative cancer therapies, Vol. 16, Issue 4, pp. 505-515, 2018 (PubMed).

    Qin, Ke, Zhou, Wang, Liang, Wang, Yang, Gao, Ye, Kumar, Wang: "Metastasis-Associated Protein 1 Deficiency Results in Compromised Pulmonary Alveolar Capillary Angiogenesis in Mice." in: Medical science monitor : international medical journal of experimental and clinical research, Vol. 23, pp. 3932-3941, 2018 (PubMed).

    Yang, Chen, Wang, Xian, Zhang, Zhu, Pan, Cheng: "TLR4 promotes the expression of HIF-1α by triggering reactive oxygen species in cervical cancer cells in vitro-implications for therapeutic intervention." in: Molecular medicine reports, Vol. 17, Issue 2, pp. 2229-2238, 2018 (PubMed).

    Guo, Mu, Yu, Li, Chen, Wei, Bi, Yu, Liang: "Comparison of the expression of TGF-β1, E-cadherin, N-cadherin, TP53, RB1CC1 and HIF-1α in oral squamous cell carcinoma and lymph node metastases of humans and mice." in: Oncology letters, Vol. 15, Issue 2, pp. 1639-1645, 2018 (PubMed).

    Gao, Chen, Gao, Wang, Sun, Yang: "CD47 deficiency in tumor stroma promotes tumor progression by enhancing angiogenesis." in: Oncotarget, Vol. 8, Issue 14, pp. 22406-22413, 2017 (PubMed).

    Wan, Wu: "Hyperthermia induced HIF-1a expression of lung cancer through AKT and ERK signaling pathways." in: Journal of experimental & clinical cancer research : CR, Vol. 35, Issue 1, pp. 119, 2017 (PubMed).

    Li, Shi, Huang, Wang, Yu, Guo, Ren: "Suppression of the expression of hypoxia-inducible factor-1α by RNA interference alleviates hypoxia-induced pulmonary hypertension in adult rats." in: International journal of molecular medicine, Vol. 38, Issue 6, pp. 1786-1794, 2017 (PubMed).

    Liu, Murray-Stewart, Casero, Kagiampakis, Jin, Zhang, Wang, Che, Tong, Ke, Jiang, Wang, Wan: "Targeting hexokinase 2 inhibition promotes radiosensitization in HPV16 E7-induced cervical cancer and suppresses tumor growth." in: International journal of oncology, Vol. 50, Issue 6, pp. 2011-2023, 2017 (PubMed).

    Ding, Chen, Xu, Qin: "Effect of Hyperbaric Oxygen on the Growth of Intracranial Glioma in Rats." in: Chinese medical journal, Vol. 128, Issue 23, pp. 3197-203, 2016 (PubMed).

    Wan, Wu, Zhang: "Local recurrence of small cell lung cancer following radiofrequency ablation is induced by HIF-1α expression in the transition zone." in: Oncology reports, Vol. 35, Issue 3, pp. 1297-308, 2016 (PubMed).

    Wang, Fang, Tan, Zhang, Ma: "Hypoxic preconditioning increases the protective effect of bone marrow mesenchymal stem cells on spinal cord ischemia/reperfusion injury." in: Molecular medicine reports, Vol. 13, Issue 3, pp. 1953-60, 2016 (PubMed).

    Wu, Ye, Deng, Wu, Li, Zhang: "Upregulation of metastasis-associated gene 2 promotes cell proliferation and invasion in nasopharyngeal carcinoma." in: OncoTargets and therapy, Vol. 9, pp. 1647-56, 2016 (PubMed).

    Xu, Dong: "Role of hypoxia-inducible factor-1α in pathogenesis and disease evaluation of ulcerative colitis." in: Experimental and therapeutic medicine, Vol. 11, Issue 4, pp. 1330-1334, 2016 (PubMed).

    Ren, Wang, Xu, Dai: "Effect of rapamycin on endometriosis in mice." in: Experimental and therapeutic medicine, Vol. 12, Issue 1, pp. 101-106, 2016 (PubMed).

    Sun, He, Geng: "Neuroprotective mechanism of HIF-1α overexpression in the early stage of acute cerebral infarction in rats." in: Experimental and therapeutic medicine, Vol. 12, Issue 1, pp. 391-395, 2016 (PubMed).

    Dai, Sun, Yao, Chen, Yu, Long: "Exposure to concentrated ambient fine particulate matter disrupts vascular endothelial cell barrier function via the IL-6/HIF-1α signaling pathway." in: FEBS open bio, Vol. 6, Issue 7, pp. 720-8, 2016 (PubMed).

    Wang, Jing, Shan, Chen, Guo, Cao, Mu, Peng, Zhou, Li: "Semaphorin 4D and hypoxia-inducible factor-1α overexpression is related to prognosis in colorectal carcinoma." in: World journal of gastroenterology, Vol. 21, Issue 7, pp. 2191-8, 2015 (PubMed).

    Wang, Wu, Guo, Zhang, Zhang, Zhan: "Increased hypoxia-inducible factor 1alpha expression in rat brain tissues in response to aging." in: Neural regeneration research, Vol. 7, Issue 10, pp. 778-82, 2015 (PubMed).

    Wu, Wang, Zhang, Zhang, Zhang, Zhang: "Puerarin decreases hypoxia inducible factor-1 alpha in the hippocampus of vascular dementia rats." in: Neural regeneration research, Vol. 7, Issue 6, pp. 421-5, 2015 (PubMed).

    Feng, Tao, Dawei, Xuliang, Xiaodong: "HIF-1? expression correlates with cellular apoptosis, angiogenesis and clinical prognosis in rectal carcinoma." in: Pathology oncology research : POR, Vol. 20, Issue 3, pp. 603-10, 2014 (PubMed).

  • Target
    HIF1A
    Alternative Name
    HIF1A (HIF1A Antibody Abstract)
    Synonyms
    hif1a, AA959795, HIF1alpha, MOP1, bHLHe78, HIF-1A, HIF-1alpha, HIF1, HIF1-ALPHA, PASD8, HIF1-alpha, hif-1a, hypoxia inducible factor 1 alpha, hypoxia inducible factor 1, alpha subunit, hypoxia inducible factor 1 alpha subunit, HIF (Hypoxia Inducible Factor) homologa, hif-1a, Hif1a, HIF1A, hif1a, hif-1
    Background
    HIF-1α (Hypoxia-inducible factor 1α, HIF1A) is a transcription factor that mediates cellular and systemic homeostatic responses to reduced O2 availability in mammals, including angiogenesis, erythropoiesis and glycolysis. This gene was mapped to 14q21-q24. HIF-1α transactivate genes required for energy metabolism and tissue perfusion and is necessary for embryonic development and tumor explant growth. HIF-1alpha is over expressed during carcinogenesis, myocardial infarction and wound healing. It is crucial for the cellular response to hypoxia and is frequently over expressed in human cancers, resulting in the activation of genes essential for cell survival. HIF-1α regulates the survival and function in the inflammatory microenvironment directly. It is a transcription factor that plays a pivotal role in cellular adaptation to changes in oxygen availability.

    Synonyms: ARNT interacting protein antibody|ARNT-interacting protein antibody|Basic helix loop helix PAS protein MOP1 antibody|Basic-helix-loop-helix-PAS protein MOP1 antibody|bHLHe78 antibody|Class E basic helix-loop-helix protein 78 antibody|HIF 1A antibody|HIF 1alpha antibody|HIF-1-alpha antibody|HIF1 A antibody|HIF1 Alpha antibody|HIF1 antibody|HIF1-alpha antibody|HIF1A antibody|HIF1A_HUMAN antibody|Hypoxia inducible factor 1 alpha antibody|Hypoxia inducible factor 1 alpha isoform I.3 antibody|Hypoxia inducible factor 1 alpha subunit antibody|Hypoxia inducible factor 1 alpha subunit basic helix loop helix transcription factor antibody|Hypoxia inducible factor 1, alpha subunit (basic helix loop helix transcription factor) antibody|Hypoxia inducible factor1alpha antibody|Hypoxia-inducible factor 1-alpha antibody|Member of PAS protein 1 antibody|Member of PAS superfamily 1 antibody|Member of the PAS Superfamily 1 antibody|MOP 1 antibody|MOP1 antibody|PAS domain-containing protein 8 antibody|PASD 8 antibody|PASD8 antibody
    Gene ID
    3091
    UniProt
    Q16665
    Pathways
    Positive Regulation of Peptide Hormone Secretion, Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Transition Metal Ion Homeostasis, Tube Formation, Regulation of Carbohydrate Metabolic Process, Signaling Events mediated by VEGFR1 and VEGFR2, VEGFR1 Specific Signals
You are here:
help Support