PTP4A2 antibody (N-Term)

Catalog No. ABIN3043911

Product Details anti-PTP4A2 Antibody

Target: PTP4A2 (Protein tyrosine Phosphatase Type IVA, Member 2 (PTP4A2))

Binding Specificity: AA 40-69, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTP4A2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Protein tyrosine phosphatase type IVA 2(PTP4A2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: TTLVRVCDAT YDKAPVEKEG IHVLDWPFDD

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Protein tyrosine phosphatase type IVA 2(PTP4A2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: protein tyrosine phosphatase type IVA, member 2
Protein Name: Protein tyrosine phosphatase type IVA 2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PTP4A2 (40-69aa TTLVRVCDATYDKAPVEKEGIHVLDWPFDD), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for PTP4A2

Target: PTP4A2 (Protein tyrosine Phosphatase Type IVA, Member 2 (PTP4A2))

Alternative Name: PTP4A2 (PTP4A2 Products)

Synonyms: wu:fc05f09 antibody, wu:fi84b06 antibody, zgc:101724 antibody, MGC53390 antibody, MGC80084 antibody, MGC132077 antibody, PTP4A2 antibody, ptp4a2 antibody, Prl-2 antibody, HH13 antibody, HH7-2 antibody, HU-PP-1 antibody, OV-1 antibody, PRL-2 antibody, PRL2 antibody, PTP4A antibody, PTPCAAX2 antibody, ptp-IV1a antibody, ptp-IV1b antibody, protein tyrosine phosphatase type IVA, member 2b antibody, protein tyrosine phosphatase 4a2 antibody, protein tyrosine phosphatase type IVA, member 2 antibody, protein tyrosine phosphatase type IVA, member 2 L homeolog antibody, ptp4a2b antibody, ptp4a2 antibody, PTP4A2 antibody, ptp4a2.L antibody, Ptp4a2 antibody

Background: Protein tyrosine phosphatase type IVA 2 is an enzyme that in humans is encoded by the PTP4A2 gene. The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17.

Synonyms: BM 008 antibody|EC 3.1.3.48 antibody|HH 13 antibody|HH13 antibody|HH7 2 antibody|HU PP 1 antibody|HUPP 1 antibody|HUPP1 antibody|OV 1 antibody|OV1 antibody|phosphatase of regenerating liver 2 antibody|PRL 2 antibody|PRL2 antibody|Protein tyrosine phosphatase 4a2 antibody|protein tyrosine phosphatase IVA antibody|protein tyrosine phosphatase IVA2 antibody|Protein tyrosine phosphatase of regenerating liver 2 antibody|protein tyrosine phosphatase type IVA 2 antibody|Protein tyrosine phosphatase type IVA member 2 isoform 1 antibody|protein tyrosine phosphatase type IVA, member 2 antibody|PTP (CAAXII) antibody|ptp IV1a antibody|ptp IV1b antibody|PTP4A antibody|PTPCAAX2 antibody|TP4A2_HUMAN antibody

Gene ID: 8073

UniProt: Q12974