Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Retinoblastoma Binding Protein 4 antibody (C-Term)

RBBP4 Reactivity: Human, Mouse, Rat WB, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN3043920
  • Target See all Retinoblastoma Binding Protein 4 (RBBP4) Antibodies
    Retinoblastoma Binding Protein 4 (RBBP4)
    Binding Specificity
    • 15
    • 11
    • 6
    • 4
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 395-425, C-Term
    Reactivity
    • 51
    • 45
    • 41
    • 7
    • 6
    • 5
    • 5
    • 5
    • 4
    • 4
    • 4
    • 4
    • 3
    • 3
    Human, Mouse, Rat
    Host
    • 57
    • 8
    • 2
    Rabbit
    Clonality
    • 50
    • 17
    Polyclonal
    Conjugate
    • 31
    • 4
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This Retinoblastoma Binding Protein 4 antibody is un-conjugated
    Application
    • 28
    • 19
    • 15
    • 15
    • 14
    • 14
    • 13
    • 8
    • 8
    • 6
    • 3
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit IgG polyclonal antibody for Histone-binding protein RBBP4(RBBP4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Sequence
    EDNIMQVWQM AENIYNDEDP EGSVDPEGQG S
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for Histone-binding protein RBBP4(RBBP4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: retinoblastoma binding protein 4
    Protein Name: Histone-binding protein RBBP4
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human RbAp48 (395-425aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS), identical to the related mouse sequence.
    Isotype
    IgG
    Top Product
    Discover our top product RBBP4 Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handling Advice
    Avoid repeated freezing and thawing.
    Storage
    4 °C/-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Target
    Retinoblastoma Binding Protein 4 (RBBP4)
    Alternative Name
    RBBP4 (RBBP4 Products)
    Synonyms
    NURF55 antibody, RBAP48 antibody, 154659_at antibody, 55 antibody, CAF-1 antibody, CAF1 antibody, CAF1-55 antibody, CAF1p55 antibody, CG4236 antibody, Caf-1 antibody, Caf1/p55 antibody, Caf1p55 antibody, Dmel\\CG4236 antibody, MSI1/RbAp48/CAC3/LIN-53 antibody, NURF antibody, NURF-55 antibody, Nurf antibody, Nurf 55 antibody, Nurf-55 antibody, Nurf55 antibody, P55 antibody, RbAp48 antibody, S(ls)3 antibody, caf-1 antibody, caf1 antibody, caf1 p55 antibody, d-CAF1 antibody, dCAF-1 antibody, dCAF-1 p55 antibody, dNURF antibody, p55 antibody, p55 CAF1 antibody, p55/NURF-55 antibody, p55CAF1 antibody, nurf55 antibody, rbap48 antibody, xrbbp4 antibody, mRbAp48 antibody, RBBP4 antibody, rbb4-2 antibody, zgc:55349 antibody, zgc:77854 antibody, wu:fb33a09 antibody, wu:fb40e10 antibody, RBBP-4 antibody, rbbp4 antibody, M4E13.110 antibody, M4E13_110 antibody, MULTICOPY SUPPRESSOR OF IRA1 3 antibody, NFC3 antibody, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP C 3 antibody, RB binding protein 4, chromatin remodeling factor antibody, Chromatin assembly factor 1, p55 subunit antibody, retinoblastoma binding protein 4 antibody, retinoblastoma binding protein 4, chromatin remodeling factor antibody, retinoblastoma binding protein 4 L homeolog antibody, Transducin family protein / WD-40 repeat family protein antibody, retinoblastoma binding protein 4 S homeolog antibody, RBBP4 antibody, Caf1-55 antibody, rbbp4 antibody, Rbbp4 antibody, rbbp4.L antibody, MSI3 antibody, rbbp4.S antibody
    Background
    Histone-binding protein RBBP4 (also known as RbAp48, or NURF55) is a protein that in humans is encoded by the RBBP4 gene. This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. And it is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene.

    Synonyms: CAF I p48 antibody|CAF-1 subunit C antibody|CAF-I 48 kDa subunit antibody|CAF-I p48 antibody|Chromatin assembly factor 1 subunit C antibody|Chromatin assembly factor I p48 subunit antibody|Chromatin assembly factor/CAF 1 p48 subunit antibody|Histone-binding protein RBBP4 antibody|MSI1 protein homolog antibody|Nucleosome-remodeling factor subunit RBAP48 antibody|NURF55 antibody|RbAp 48 antibody| RBAP48 antibody|RBBP-4 antibody|RBBP4 antibody|RBBP4_HUMAN antibody|Retinoblastoma binding protein 4 antibody|Retinoblastoma binding protein p48 antibody|Retinoblastoma-binding protein 4 antibody|Retinoblastoma-binding protein p48 antibody
    Gene ID
    5928
    UniProt
    Q09028
    Pathways
    Cell Division Cycle, Mitotic G1-G1/S Phases, Stem Cell Maintenance, Chromatin Binding, Protein targeting to Nucleus
You are here:
Support