Retinoblastoma Binding Protein 4 antibody (C-Term)

Catalog No. ABIN5692929

Product Details anti-Retinoblastoma Binding Protein 4 Antibody

Target: Retinoblastoma Binding Protein 4 (RBBP4)

Binding Specificity: AA 395-425, C-Term

Reactivity: Human, Mouse, Rat

Host: Mouse

Clonality: Monoclonal

Conjugate: This Retinoblastoma Binding Protein 4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Brand: Picoband™

Sequence: EDNIMQVWQM AENIYNDEDP EGSVDPEGQG S

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Mouse IgG monoclonal antibody for RbAp48 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human RbAp48 (395-425aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS), identical to the related mouse sequence.

Clone: 9F3

Isotype: IgG1

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage Comment: At -20℃, for one year. After reconstitution, at 4℃, for one month.
It can also be aliquotted and stored frozen at -20℃, for a longer time. Avoid repeated freezing and thawing.

Target Details for Retinoblastoma Binding Protein 4

Target: Retinoblastoma Binding Protein 4 (RBBP4)

Alternative Name: RBBP4 (RBBP4 Products)

Synonyms: NURF55 antibody, RBAP48 antibody, 154659_at antibody, 55 antibody, CAF-1 antibody, CAF1 antibody, CAF1-55 antibody, CAF1p55 antibody, CG4236 antibody, Caf-1 antibody, Caf1/p55 antibody, Caf1p55 antibody, Dmel\\CG4236 antibody, MSI1/RbAp48/CAC3/LIN-53 antibody, NURF antibody, NURF-55 antibody, Nurf antibody, Nurf 55 antibody, Nurf-55 antibody, Nurf55 antibody, P55 antibody, RbAp48 antibody, S(ls)3 antibody, caf-1 antibody, caf1 antibody, caf1 p55 antibody, d-CAF1 antibody, dCAF-1 antibody, dCAF-1 p55 antibody, dNURF antibody, p55 antibody, p55 CAF1 antibody, p55/NURF-55 antibody, p55CAF1 antibody, nurf55 antibody, rbap48 antibody, xrbbp4 antibody, mRbAp48 antibody, RBBP4 antibody, rbb4-2 antibody, zgc:55349 antibody, zgc:77854 antibody, wu:fb33a09 antibody, wu:fb40e10 antibody, RBBP-4 antibody, rbbp4 antibody, M4E13.110 antibody, M4E13_110 antibody, MULTICOPY SUPPRESSOR OF IRA1 3 antibody, NFC3 antibody, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP C 3 antibody, RB binding protein 4, chromatin remodeling factor antibody, Chromatin assembly factor 1, p55 subunit antibody, retinoblastoma binding protein 4 antibody, retinoblastoma binding protein 4, chromatin remodeling factor antibody, retinoblastoma binding protein 4 L homeolog antibody, Transducin family protein / WD-40 repeat family protein antibody, retinoblastoma binding protein 4 S homeolog antibody, RBBP4 antibody, Caf1-55 antibody, rbbp4 antibody, Rbbp4 antibody, rbbp4.L antibody, MSI3 antibody, rbbp4.S antibody

Background:

Synonyms: Histone-binding protein RBBP4, Chromatin assembly factor 1 subunit C, CAF-1 subunit C, Chromatin assembly factor I p48 subunit, CAF-I 48 kDa subunit, CAF-I p48, Nucleosome-remodeling factor subunit RBAP48, Retinoblastoma-binding protein 4, RBBP-4, Retinoblastoma-binding protein p48, RBBP4, RBAP48

Background: Histone-binding protein RBBP4 (also known as RbAp48, or NURF55) is a protein that in humans is encoded by the RBBP4 gene. This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. And it is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene.

UniProt: Q09028

Pathways: Cell Division Cycle, Mitotic G1-G1/S Phases, Stem Cell Maintenance, Chromatin Binding, Protein targeting to Nucleus