STAT1 antibody (Signal Transducer and Activator of Transcription 1, 91kDa) (AA 114-143)

Details for Product anti-STAT1 Antibody No. ABIN3043938
Target
Binding Specificity
AA 114-143, N-Term
50
37
29
17
15
15
8
8
5
5
4
4
4
4
3
3
3
3
3
3
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Human, Mouse, Rat
293
160
155
24
24
23
20
18
13
10
8
6
5
5
2
1
1
1
1
1
Host
Rabbit
237
63
2
2
1
Clonality
Polyclonal
Conjugate
This STAT1 antibody is un-conjugated
15
11
11
10
9
9
9
8
8
5
5
4
4
4
4
4
3
2
2
2
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
207
96
88
60
55
47
23
22
11
8
4
4
4
1
1
Options
Purpose Rabbit IgG polyclonal antibody for Signal transducer and activator of transcription 1-alpha/beta (STAT1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human STAT1 (114-143aa KILENAQRFNQAQSGNIQSTVMLDKQKELD), different from the related mouse sequence by two amino acids.
Sequence KILENAQRFN QAQSGNIQST VMLDKQKELD
Isotype IgG
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Signal transducer and activator of transcription 1-alpha/beta (STAT1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: signal transducer and activator of transcription 1, 91 kDa
Protein Name: Signal transducer and activator of transcription 1-alpha/beta
Purification Immunogen affinity purified.
Target
Alternative Name STAT1 (STAT1 Antibody Abstract)
Background Signal transducer and activator of transcription 1 (STAT1) is a transcription factor which in humans is encoded by the STAT1 gene. The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. Two alternatively spliced transcript variants encoding distinct isoforms have been described.

Synonyms: Signal transducer and activator of transcription 1 91kD antibody|DKFZp686B04100 antibody| ISGF 3 antibody|ISGF-3 antibody|OTTHUMP00000163552 antibody|OTTHUMP00000165046 antibody| OTTHUMP00000165047 antibody|OTTHUMP00000205845 antibody|Signal transducer and activator of transcription 1 91 kDa antibody|Signal transducer and activator of transcription 1 alpha/ beta antibody|Signal transducer and activator of transcription 1 antibody|Signal transducer and activator of transcription 1, 91kD antibody|Signal transducer and activator of transcription 1-alpha/beta antibody|Signal Transductor and Activator of Transcription 1 antibody|STAT 1 antibody|STAT 91 antibody|Stat1 antibody|STAT1_HUMAN antibody|STAT91 antibody|Transcription factor ISGF 3 components p91 p84 antibody|Transcription factor ISGF-3 components p91/p84 antibody
Gene ID 6772
UniProt P42224
Pathways JAK-STAT Signaling, RTK Signaling, Interferon-gamma Pathway, Response to Growth Hormone Stimulus, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Endopeptidase Activity, Hepatitis C, CXCR4-mediated Signaling Events
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Comment

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Signal Transducer and Activator of Transcription 1, 91kDa (STAT1) (AA 114-143), (N-Term) antibody (ABIN3043938) anti-Signal Transducer and Activator of Transcription 1, 91kDa (STAT1) (AA 114-143), (N-Term) antibody (Image 1)
Image no. 2 for anti-Signal Transducer and Activator of Transcription 1, 91kDa (STAT1) (AA 114-143), (N-Term) antibody (ABIN3043938) Anti- STAT1 Picoband antibody, IHC(P) IHC(P): Mouse Intestine Tissue
Image no. 3 for anti-Signal Transducer and Activator of Transcription 1, 91kDa (STAT1) (AA 114-143), (N-Term) antibody (ABIN3043938) Anti- STAT1 Picoband antibody, IHC(P) IHC(P): Human Mammary Cancer Tissue
Image no. 4 for anti-Signal Transducer and Activator of Transcription 1, 91kDa (STAT1) (AA 114-143), (N-Term) antibody (ABIN3043938) Anti- STAT1 Picoband antibody, IHC(P) IHC(P): Rat Intestine Tissue
Product cited in: Liu, Li, Liang, Li, Jiang, Chu, Yang: "Hydrogen sulfide attenuates myocardial fibrosis in diabetic rats through the JAK/STAT signaling pathway." in: International journal of molecular medicine, Vol. 41, Issue 4, pp. 1867-1876, 2018 (PubMed).

Song, Yang, Min, Liu, Zhao: "The effect of procyanidin on expression of STAT1 in type 2 diabetes mellitus SD rats with focal cerebral ischemia." in: Neuro endocrinology letters, Vol. 35, Issue 1, pp. 68-72, 2014 (PubMed).

Gong, Cao, Jiang, Zhou, Liu: "Hepatitis C virus non-structural 5A abrogates signal transducer and activator of transcription-1 nuclear translocation induced by IFN-alpha through dephosphorylation." in: World journal of gastroenterology, Vol. 13, Issue 30, pp. 4080-4, 2007 (PubMed).