TLR4 antibody (AA 161-192)

Catalog No. ABIN342783

This anti-TLR4 antibody is a Goat Polyclonal antibody detecting TLR4 in WB and ICC. Suitable for Human.

Quick Overview for TLR4 antibody (AA 161-192) (ABIN342783)

Target: TLR4 (Toll-Like Receptor 4 (TLR4))

Reactivity: Human

Host: Goat

Clonality: Polyclonal

Conjugate: This TLR4 antibody is un-conjugated

Application: Western Blotting (WB), Immunocytochemistry (ICC)

Product Details anti-TLR4 Antibody

Binding Specificity: AA 161-192

Specificity: Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR4, mouse, and rat TLR4.

Predicted Reactivity: Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon (100%) Gorilla, Baboon, Monkey (97%) Marmoset (94%) Hamster (87%) Sheep, Goat, Zebu, Bovine (84%) Rat, Dolphin, Panda, Bat, Cat, Pig (81%).

Purification: Immunoaffinity purified

Immunogen: Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to aa 161-192 of the N-terminal domain of Human TLR4. Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon (100%), Gorilla, Baboon, Monkey (97%), Marmoset (94%), Hamster (87%), Sheep, Goat, Zebu, Bovine (84%), Rat, Dolphin, Panda, Bat, Cat, Pig (81%).

Type of Immunogen: Synthetic peptide

Application Details

Application Notes: Approved: ICC (1:200), WB

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: Phosphate buffered saline, 1 mg/mL BSA, 0.1 % sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Aliquot to Avoid freeze/thaw cycles.

Storage: -20 °C

Storage Comment: Store at -20°C. Aliquot to avoid freeze/thaw cycles.

Target Details for TLR4

Target: TLR4 (Toll-Like Receptor 4 (TLR4))

Alternative Name: TLR4

Background: Name/Gene ID: TLR4
Family: Toll-like Receptor

Synonyms: TLR4, CD284, CD284 antigen, Homolog of Drosophila toll, TLR-4, TOLL, ARMD10, Toll-like receptor 4, HToll

Gene ID: 7099

UniProt: O00206

Pathways: TLR Signaling, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Toll-Like Receptors Cascades, Inflammasome, S100 Proteins