TLR10 antibody (AA 81-111)
-
- Target See all TLR10 Antibodies
- TLR10 (Toll-Like Receptor 10 (TLR10))
-
Binding Specificity
- AA 81-111
-
Reactivity
- Human
-
Host
- Goat
-
Clonality
- Polyclonal
-
Conjugate
- This TLR10 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC)
- Specificity
- Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR10.
- Predicted Reactivity
- Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon (100%) Orangutan, Monkey (97%) Marmoset (94%) Sheep, Goat, Zebu, Bovine (87%) Elephant, Horse (84%) Panda, Pig (81%).
- Purification
- Immunoaffinity purified
- Immunogen
-
31 amino acid (aa) synthetic peptide C-HNRIQQLDLKTFEFNKELRYLDLSNNRLKSV corresponding to aa 81-111 of the N-terminal domain of Human TLR10. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon (100%), Orangutan, Monkey (97%), Marmoset (94%), Sheep, Goat, Zebu, Bovine (87%), Elephant, Horse (84%), Panda, Pig (81%).
Type of Immunogen: Synthetic peptide - Top Product
- Discover our top product TLR10 Primary Antibody
-
-
- Application Notes
- Approved: ICC (1:200), IHC, WB
- Comment
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- Phosphate buffered saline, 1 mg/mL BSA, 0.1 % sodium azide
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Aliquot to Avoid freeze/thaw cycles.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C. Aliquot to avoid freeze/thaw cycles.
-
- Target
- TLR10 (Toll-Like Receptor 10 (TLR10))
- Alternative Name
- TLR10 (TLR10 Products)
- Background
-
Name/Gene ID: TLR10
Family: Toll-like Receptor
Synonyms: TLR10, CD290, CD290 antigen, Toll-like receptor 10 - Gene ID
- 81793
- UniProt
- Q9BXR5
- Pathways
- TLR Signaling, Activation of Innate immune Response, Toll-Like Receptors Cascades
-