TLR10 antibody (AA 81-111)

Catalog No. ABIN342786

Product Details anti-TLR10 Antibody

Target: TLR10 (Toll-Like Receptor 10 (TLR10))

Binding Specificity: AA 81-111

Reactivity: Human

Host: Goat

Clonality: Polyclonal

Conjugate: This TLR10 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC)

Specificity: Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR10.

Predicted Reactivity: Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon (100%) Orangutan, Monkey (97%) Marmoset (94%) Sheep, Goat, Zebu, Bovine (87%) Elephant, Horse (84%) Panda, Pig (81%).

Purification: Immunoaffinity purified

Immunogen: 31 amino acid (aa) synthetic peptide C-HNRIQQLDLKTFEFNKELRYLDLSNNRLKSV corresponding to aa 81-111 of the N-terminal domain of Human TLR10. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon (100%), Orangutan, Monkey (97%), Marmoset (94%), Sheep, Goat, Zebu, Bovine (87%), Elephant, Horse (84%), Panda, Pig (81%).

Type of Immunogen: Synthetic peptide

Application Details

Application Notes: Approved: ICC (1:200), IHC, WB

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: Phosphate buffered saline, 1 mg/mL BSA, 0.1 % sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Aliquot to Avoid freeze/thaw cycles.

Storage: -20 °C

Storage Comment: Store at -20°C. Aliquot to avoid freeze/thaw cycles.

Target Details for TLR10

Target: TLR10 (Toll-Like Receptor 10 (TLR10))

Alternative Name: TLR10 (TLR10 Products)

Synonyms: TLR10 antibody, CD290 antibody, toll like receptor 10 antibody, toll-like receptor 10 antibody, TLR10 antibody, Tlr10 antibody

Background: Name/Gene ID: TLR10
Family: Toll-like Receptor

Synonyms: TLR10, CD290, CD290 antigen, Toll-like receptor 10

Gene ID: 81793

UniProt: Q9BXR5

Pathways: TLR Signaling, Activation of Innate immune Response, Toll-Like Receptors Cascades