Adenylate Kinase 1 antibody (C-Term)

Catalog No. ABIN4886445

Product Details anti-Adenylate Kinase 1 Antibody

Target: Adenylate Kinase 1 (AK1)

Binding Specificity: AA 149-189, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Adenylate Kinase 1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Adenylate kinase isoenzyme 1(AK1) detection. Tested with WB in Human,Mouse,Rat.

Sequence: RLETYYKATE PVIAFYEKRG IVRKVNAEGS VDSVF

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Adenylate kinase isoenzyme 1(AK1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: adenylate kinase 1
Protein Name: Adenylate kinase isoenzyme 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Adenylate Kinase 1 (149-189aa RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVF SQVCTH), different from the related mouse sequence by seven amino acids, and from the related rat sequence by four amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for Adenylate Kinase 1

Target: Adenylate Kinase 1 (AK1)

Alternative Name: AK1 (AK1 Products)

Synonyms: ADK-1 antibody, AK1 antibody, CG17146 antibody, DAK1 antibody, Dak1 antibody, Dmel\\CG17146 antibody, adk1 antibody, bs34e10.y1 antibody, ak5 antibody, ADENYLATE KINASE 1 antibody, MLE2.3 antibody, MLE2_3 antibody, adenylate kinase 1 antibody, Ak-1 antibody, B430205N08Rik antibody, Ak 1 antibody, zgc:91930 antibody, Myokinase antibody, Adenylate kinase 1 antibody, adenylate kinase 1 antibody, Adk1 antibody, ak1 antibody, AK1 antibody, ADK1 antibody, Ak1 antibody

Background: This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.

Synonyms: Adenylate kinase 1 | AK 1 | AK1 | ATP-AMP transphosphorylase 1 | KAD1 | Myokinase | P00568

Gene ID: 203

UniProt: P00568

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process