AMACR antibody (Middle Region)
-
- Target See all AMACR Antibodies
- AMACR (alpha-Methylacyl-CoA Racemase (AMACR))
-
Binding Specificity
- AA 208-246, Middle Region
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AMACR antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Alpha-methylacyl-CoA racemase(AMACR) detection. Tested with WB in Human,Rat.
- Sequence
- RGQNMLDGGA PFYTTYRTAD GEFMAVGAIE PQFYELLIK
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Alpha-methylacyl-CoA racemase(AMACR) detection. Tested with WB in Human,Rat.
Gene Name: alpha-methylacyl-CoA racemase
Protein Name: Alpha-methylacyl-CoA racemase - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human AMACR (208-246aa RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK), different from the related mouse and rat sequences by four amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product AMACR Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
A metanephric adenoma of the kidney associated with polycythemia: A case report." in: Oncology letters, Vol. 11, Issue 1, pp. 352-354, (2016) (PubMed).
: "
-
A metanephric adenoma of the kidney associated with polycythemia: A case report." in: Oncology letters, Vol. 11, Issue 1, pp. 352-354, (2016) (PubMed).
-
- Target
- AMACR (alpha-Methylacyl-CoA Racemase (AMACR))
- Alternative Name
- AMACR (AMACR Products)
- Synonyms
- AMACR antibody, DKFZp469O1232 antibody, amacr antibody, NCU04099.1 antibody, MGC89832 antibody, AMACRD antibody, CBAS4 antibody, RACE antibody, RM antibody, Macr1 antibody, Da1-8 antibody, Marc1 antibody, alpha-methylacyl-CoA racemase antibody, PROBABLE ALPHA-METHYLACYL-COA RACEMASE MCR (2-methylacyl-CoA racemase) (2-arylpropionyl-CoA epimerase) antibody, Alpha-methylacyl-CoA racemase antibody, alpha-methylacyl-CoA racemase L homeolog antibody, AMACR antibody, mcr antibody, BPSL0064 antibody, Maqu_2037 antibody, UREG_03852 antibody, MCYG_01809 antibody, amacr antibody, amacr.L antibody, MGYG_04259 antibody, NCU04099 antibody, Amacr antibody
- Background
-
Alpha-methylacyl-CoA racemase (AMACR) is a mitochondrial and peroxisomal enzyme. It encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene.
Synonyms: 2 arylpropionyl CoA epimerase | 2 methylacyl CoA racemase | 2-methylacyl-CoA racemase | Alpha methylacyl CoA racemase | Alpha-methylacyl-CoA racemase | Amacr | CBAS4 | Da1-8 | Macr1 | RACE | RM | Q9UHK6 - Gene ID
- 23600
- Pathways
- Monocarboxylic Acid Catabolic Process
-