ARHGEF1 antibody (N-Term)

Catalog No. ABIN4886475

Product Details anti-ARHGEF1 Antibody

Target: ARHGEF1 (rho Guanine Nucleotide Exchange Factor (GEF) 1 (ARHGEF1))

Binding Specificity: AA 41-71, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARHGEF1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Rho guanine nucleotide exchange factor 1(ARHGEF1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: EQNSQFQSLE QVKRRPAHLM ALLQHVALQF E

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Rho guanine nucleotide exchange factor 1(ARHGEF1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: Rho guanine nucleotide exchange factor 1
Protein Name: Rho guanine nucleotide exchange factor 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ARHGEF1 (41-71aa EQNSQFQSLEQVKRRPAHLMALLQHVALQFE), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ARHGEF1

Target: ARHGEF1 (rho Guanine Nucleotide Exchange Factor (GEF) 1 (ARHGEF1))

Alternative Name: ARHGEF1 (ARHGEF1 Products)

Synonyms: arhgef1 antibody, cb473 antibody, zgc:158261 antibody, ARHGEF1 antibody, GEF1 antibody, LBCL2 antibody, LSC antibody, P115-RHOGEF antibody, SUB1.5 antibody, Lbcl2 antibody, Lsc antibody, Rho guanine nucleotide exchange factor (GEF) 1a antibody, Rho guanine nucleotide exchange factor 1 antibody, Rho guanine nucleotide exchange factor (GEF) 1 antibody, arhgef1a antibody, ARHGEF1 antibody, arhgef1 antibody, Arhgef1 antibody

Background: Rho guanine nucleotide exchange factor 1 is a protein that in humans is encoded by the ARHGEF1 gene. Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Synonyms: ARHGEF 1 | ARHGEF1 | GEF 1 | GEF1 | LBCL 2 | LBCL2 | LSC | p115 RhoGEF | p115-RhoGEF | p115RhoGEF | Q92888

Gene ID: 9138

UniProt: Q92888

Pathways: Neurotrophin Signaling Pathway, Regulation of G-Protein Coupled Receptor Protein Signaling, Thromboxane A2 Receptor Signaling