CYP17A1 antibody (C-Term)
-
- Target See all CYP17A1 Antibodies
- CYP17A1 (Cytochrome P450, Family 17, Subfamily A, Polypeptide 1 (CYP17A1))
-
Binding Specificity
- AA 383-419, C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP17A1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Steroid 17-alpha-hydroxylase/17,20 lyase(CYP17A1) detection. Tested with WB, IHC-P in Human.
- Sequence
- EFAVDKGTEV IINLWALHHN EKEWHQPDQF MPERFLN
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Steroid 17-alpha-hydroxylase/17,20 lyase(CYP17A1) detection. Tested with WB, IHC-P in Human.
Gene Name: cytochrome P450 family 17 subfamily A member 1
Protein Name: Steroid 17-alpha-hydroxylase/17,20 lyase - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human CYP17A1 (383-419aa EFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLN), different from the related mouse and rat sequences by ten amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product CYP17A1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- CYP17A1 (Cytochrome P450, Family 17, Subfamily A, Polypeptide 1 (CYP17A1))
- Alternative Name
- CYP17A1 (CYP17A1 Products)
- Synonyms
- cyp17 antibody, CYPXVII antibody, P450c17 antibody, cyp17a1 antibody, P450-C17 antibody, wu:fi13g04 antibody, wu:fi17b11 antibody, wu:fi31c08 antibody, zgc:136516 antibody, zgc:66494 antibody, P45017A1 antibody, CYP17 antibody, CPT7 antibody, P450C17 antibody, S17AH antibody, Cyp17 antibody, p450c17 antibody, cytochrome P450 17A1 antibody, cytochrome P450, family 17, subfamily A, polypeptide 1 antibody, steroidogenic cytochrome P450 17-hydroxylase/lyase antibody, cytochrome P450 family 17 subfamily A member 1 L homeolog antibody, cytochrome P450 family 17 subfamily A member 1 antibody, cytochrome P-450 17 alpha-hydroxylase/C17,20-lyase antibody, cytochrome P450, family 17, subfamily a, polypeptide 1 antibody, cytochrome P450c17 antibody, CpipJ_CPIJ010537 antibody, CpipJ_CPIJ010543 antibody, PTRG_02047 antibody, cyp17a1 antibody, cyp17 antibody, cyp17a1.L antibody, CYP17A1 antibody, Cyp17a1 antibody
- Background
-
Cytochrome P450 17A1, also called steroid 17α-monooxygenase, is an enzyme of the hydroxylase type that in humans is encoded by the CYP17A1 gene on chromosome 10. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. It has both 17alpha-hydroxylase and 17,20-lyase activities and is a key enzyme in the steroidogenic pathway that produces progestins, mineralocorticoids, glucocorticoids, androgens, and estrogens. Mutations in this gene are associated with isolated steroid-17 alpha-hydroxylase deficiency, 17-alpha-hydroxylase/17,20-lyase deficiency, pseudohermaphroditism, and adrenal hyperplasia.
Synonyms: 20 lyase | CPT7 | CYP17 | CYP17A1 | CYPXVII | P450 C17 | P450c17 | S17AH | P05093 - Gene ID
- 1586
- UniProt
- P05093
- Pathways
- Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis, Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process, C21-Steroid Hormone Metabolic Process, Cellular Response to Molecule of Bacterial Origin
-